Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 36118..36616 | Replicon | chromosome |
Accession | NZ_AP024548 | ||
Organism | Vibrio cholerae strain BCH-01536 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | K6J77_RS14125 | Protein ID | WP_000589156.1 |
Coordinates | 36118..36384 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | K6J77_RS14130 | Protein ID | WP_000643598.1 |
Coordinates | 36371..36616 (+) | Length | 82 a.a. |
Genomic Context
Location: 31646..31744 (99 bp)
Type: Others
Protein ID: WP_223225486.1
Type: Others
Protein ID: WP_223225486.1
Location: 31944..32045 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 32035..32421 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 32616..32867 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 32840..32989 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 33081..33323 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 33575..33853 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 34285..34328 (44 bp)
Type: Others
Protein ID: Protein_57
Type: Others
Protein ID: Protein_57
Location: 34310..34403 (94 bp)
Type: Others
Protein ID: Protein_58
Type: Others
Protein ID: Protein_58
Location: 34372..34503 (132 bp)
Type: Others
Protein ID: WP_001883067.1
Type: Others
Protein ID: WP_001883067.1
Location: 34675..35142 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 35270..35933 (664 bp)
Type: Others
Protein ID: Protein_61
Type: Others
Protein ID: Protein_61
Location: 35923..36051 (129 bp)
Type: Others
Protein ID: WP_088124358.1
Type: Others
Protein ID: WP_088124358.1
Location: 36118..36384 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 36371..36616 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 36712..37506 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 37503..37619 (117 bp)
Type: Others
Protein ID: WP_086010881.1
Type: Others
Protein ID: WP_086010881.1
Location: 37609..37737 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 37798..37980 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 38196..39200 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 39353..39712 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 39779..39964 (186 bp)
Type: Others
Protein ID: WP_001999468.1
Type: Others
Protein ID: WP_001999468.1
Location: 40096..40218 (123 bp)
Type: Others
Protein ID: WP_001937972.1
Type: Others
Protein ID: WP_001937972.1
Location: 40486..40992 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 41149..41535 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J77_RS18950 | 31646..31744 | + | 99 | WP_223225486.1 | DUF3709 domain-containing protein | - |
K6J77_RS14080 | 31944..32045 | + | 102 | WP_001921603.1 | hypothetical protein | - |
K6J77_RS14085 | 32035..32421 | + | 387 | WP_000703163.1 | VOC family protein | - |
K6J77_RS14090 | 32616..32867 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
K6J77_RS18955 | 32840..32989 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
K6J77_RS14095 | 33081..33323 | + | 243 | WP_000107461.1 | hypothetical protein | - |
K6J77_RS14100 | 33575..33853 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
K6J77_RS18960 | 34285..34328 | + | 44 | Protein_57 | hypothetical protein | - |
K6J77_RS18965 | 34310..34403 | + | 94 | Protein_58 | ggdef family protein | - |
K6J77_RS18970 | 34372..34503 | + | 132 | WP_001883067.1 | hypothetical protein | - |
K6J77_RS14115 | 34675..35142 | + | 468 | WP_001289288.1 | OsmC family protein | - |
K6J77_RS14120 | 35270..35933 | + | 664 | Protein_61 | hypothetical protein | - |
K6J77_RS18975 | 35923..36051 | + | 129 | WP_088124358.1 | DUF3265 domain-containing protein | - |
K6J77_RS14125 | 36118..36384 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
K6J77_RS14130 | 36371..36616 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
K6J77_RS14135 | 36712..37506 | + | 795 | WP_001911581.1 | hypothetical protein | - |
K6J77_RS18980 | 37503..37619 | + | 117 | WP_086010881.1 | DUF3265 domain-containing protein | - |
K6J77_RS14140 | 37609..37737 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
K6J77_RS14145 | 37798..37980 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
K6J77_RS14150 | 38196..39200 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
K6J77_RS14155 | 39353..39712 | + | 360 | WP_001071541.1 | VOC family protein | - |
K6J77_RS18985 | 39779..39964 | + | 186 | WP_001999468.1 | hypothetical protein | - |
K6J77_RS18990 | 40096..40218 | + | 123 | WP_001937972.1 | DUF3709 domain-containing protein | - |
K6J77_RS14165 | 40486..40992 | + | 507 | WP_000393074.1 | hypothetical protein | - |
K6J77_RS14170 | 41149..41535 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integron | - | - | 11978..113648 | 101670 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T38619 WP_000589156.1 NZ_AP024548:36118-36384 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T38619 NZ_AP024548:36118-36384 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT38619 WP_000643598.1 NZ_AP024548:36371-36616 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT38619 NZ_AP024548:36371-36616 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |