Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-Phd |
| Location | 282896..283443 | Replicon | chromosome |
| Accession | NZ_LT992493 | ||
| Organism | Vibrio cholerae strain 4295STDY6534248 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q9KM92 |
| Locus tag | DG169_RS16160 | Protein ID | WP_000229317.1 |
| Coordinates | 283141..283443 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9KM93 |
| Locus tag | DG169_RS16155 | Protein ID | WP_000861987.1 |
| Coordinates | 282896..283153 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG169_RS16100 | 277925..278380 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
| DG169_RS16105 | 278702..278854 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
| DG169_RS16115 | 279056..279553 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
| DG169_RS16120 | 279550..279822 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
| DG169_RS16125 | 280053..280721 | + | 669 | WP_000043871.1 | hypothetical protein | - |
| DG169_RS16130 | 280873..281160 | + | 288 | WP_000426470.1 | hypothetical protein | - |
| DG169_RS16135 | 281301..281672 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
| DG169_RS16140 | 281739..282164 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
| DG169_RS16145 | 282161..282694 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
| DG169_RS16155 | 282896..283153 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| DG169_RS16160 | 283141..283443 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DG169_RS16170 | 283677..284594 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
| DG169_RS16175 | 284751..285140 | + | 390 | WP_001081302.1 | hypothetical protein | - |
| DG169_RS16180 | 285276..285485 | + | 210 | Protein_325 | GNAT family N-acetyltransferase | - |
| DG169_RS16185 | 285604..286041 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
| DG169_RS16190 | 286105..286323 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
| DG169_RS16195 | 286498..287370 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
| DG169_RS16200 | 287520..288119 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
| DG169_RS16205 | 288176..288280 | + | 105 | WP_099607150.1 | acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 197768..293032 | 95264 | |
| inside | Integron | catB9 | - | 202848..292656 | 89808 | ||
| flank | IS/Tn | - | - | 285604..286041 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T294419 WP_000229317.1 NZ_LT992493:283141-283443 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9KM92 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1T4SLM9 |