294419

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-Phd
Location 282896..283443 Replicon chromosome
Accession NZ_LT992493
Organism Vibrio cholerae strain 4295STDY6534248

Toxin (Protein)


Gene name relE Uniprot ID Q9KM92
Locus tag DG169_RS16160 Protein ID WP_000229317.1
Coordinates 283141..283443 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KM93
Locus tag DG169_RS16155 Protein ID WP_000861987.1
Coordinates 282896..283153 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG169_RS16100 277925..278380 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
DG169_RS16105 278702..278854 + 153 WP_001884520.1 DUF645 family protein -
DG169_RS16115 279056..279553 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
DG169_RS16120 279550..279822 - 273 WP_000246253.1 DUF1778 domain-containing protein -
DG169_RS16125 280053..280721 + 669 WP_000043871.1 hypothetical protein -
DG169_RS16130 280873..281160 + 288 WP_000426470.1 hypothetical protein -
DG169_RS16135 281301..281672 + 372 WP_001164080.1 nucleotide pyrophosphohydrolase -
DG169_RS16140 281739..282164 + 426 WP_001882332.1 DUF1778 domain-containing protein -
DG169_RS16145 282161..282694 + 534 WP_000118351.1 GNAT family N-acetyltransferase -
DG169_RS16155 282896..283153 + 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
DG169_RS16160 283141..283443 + 303 WP_000229317.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DG169_RS16170 283677..284594 + 918 WP_000186333.1 alpha/beta hydrolase -
DG169_RS16175 284751..285140 + 390 WP_001081302.1 hypothetical protein -
DG169_RS16180 285276..285485 + 210 Protein_325 GNAT family N-acetyltransferase -
DG169_RS16185 285604..286041 + 438 WP_000503169.1 IS200/IS605-like element IS1004 family transposase -
DG169_RS16190 286105..286323 + 219 WP_071908318.1 GNAT family N-acetyltransferase -
DG169_RS16195 286498..287370 + 873 WP_000254716.1 DUF3800 domain-containing protein -
DG169_RS16200 287520..288119 + 600 WP_001891245.1 glutathione S-transferase N-terminal domain-containing protein -
DG169_RS16205 288176..288280 + 105 WP_099607150.1 acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 197768..293032 95264
inside Integron catB9 - 202848..292656 89808
flank IS/Tn - - 285604..286041 437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11726.68 Da        Isoelectric Point: 5.1972

>T294419 WP_000229317.1 NZ_LT992493:283141-283443 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9647.15 Da        Isoelectric Point: 7.3178

>AT294419 WP_000861987.1 NZ_LT992493:282896-283153 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q9KM92

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SLM9

References