Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 399506..400139 | Replicon | chromosome |
Accession | NZ_LT992489 | ||
Organism | Vibrio cholerae strain 4295STDY6534232 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | DG176_RS16225 | Protein ID | WP_000843587.1 |
Coordinates | 399807..400139 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | DG176_RS16220 | Protein ID | WP_000071008.1 |
Coordinates | 399506..399820 (-) | Length | 105 a.a. |
Genomic Context
Location: 397507..398487 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 394560..394847 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 394837..395088 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 395302..395715 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 395790..395933 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 395903..396304 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 396304..396996 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 397133..397439 (307 bp)
Type: Others
Protein ID: Protein_349
Type: Others
Protein ID: Protein_349
Location: 398612..398767 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 398935..399369 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 399506..399820 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 399807..400139 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 400480..400707 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 400656..400769 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 400935..401216 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 401165..401279 (115 bp)
Type: Others
Protein ID: Protein_358
Type: Others
Protein ID: Protein_358
Location: 401336..401713 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 401884..402126 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 402328..402714 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 402923..403094 (172 bp)
Type: Others
Protein ID: Protein_362
Type: Others
Protein ID: Protein_362
Location: 403412..403681 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 404041..404214 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 404495..404698 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG176_RS16175 | 394560..394847 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
DG176_RS16180 | 394837..395088 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
DG176_RS16185 | 395302..395715 | - | 414 | WP_000049417.1 | VOC family protein | - |
DG176_RS16190 | 395790..395933 | - | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
DG176_RS16195 | 395903..396304 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
DG176_RS16200 | 396304..396996 | - | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
DG176_RS16205 | 397133..397439 | - | 307 | Protein_349 | CatB-related O-acetyltransferase | - |
DG176_RS16210 | 397507..398487 | + | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
DG176_RS19665 | 398612..398767 | - | 156 | WP_000751734.1 | hypothetical protein | - |
DG176_RS16215 | 398935..399369 | - | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
DG176_RS16220 | 399506..399820 | - | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
DG176_RS16225 | 399807..400139 | - | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DG176_RS16235 | 400480..400707 | - | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
DG176_RS19790 | 400656..400769 | - | 114 | WP_001889158.1 | hypothetical protein | - |
DG176_RS16255 | 400935..401216 | - | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
DG176_RS19795 | 401165..401279 | - | 115 | Protein_358 | acetyltransferase | - |
DG176_RS16260 | 401336..401713 | - | 378 | WP_000411109.1 | hypothetical protein | - |
DG176_RS16265 | 401884..402126 | - | 243 | WP_000107461.1 | hypothetical protein | - |
DG176_RS16270 | 402328..402714 | - | 387 | WP_000703163.1 | VOC family protein | - |
DG176_RS19865 | 402923..403094 | - | 172 | Protein_362 | DUF645 family protein | - |
DG176_RS16280 | 403412..403681 | - | 270 | WP_001198131.1 | hypothetical protein | - |
DG176_RS16285 | 404041..404214 | - | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
DG176_RS19715 | 404495..404698 | - | 204 | WP_001911745.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 379325..476297 | 96972 | |
flank | IS/Tn | - | - | 397507..398487 | 980 | ||
inside | Integron | catB9 | - | 379701..469509 | 89808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T294376 WP_000843587.1 NZ_LT992489:c400139-399807 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp