Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 367473..367971 | Replicon | chromosome |
Accession | NZ_CP013302 | ||
Organism | Vibrio cholerae strain C5 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | ASZ80_RS16120 | Protein ID | WP_000589156.1 |
Coordinates | 367473..367739 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | ASZ80_RS16125 | Protein ID | WP_000643598.1 |
Coordinates | 367726..367971 (+) | Length | 82 a.a. |
Genomic Context
Location: 362894..363100 (207 bp)
Type: Others
Protein ID: Protein_348
Type: Others
Protein ID: Protein_348
Location: 363300..363401 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 363391..363777 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 363972..364223 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 364196..364345 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 364437..364679 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 364931..365209 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 365584..365727 (144 bp)
Type: Others
Protein ID: Protein_355
Type: Others
Protein ID: Protein_355
Location: 365781..365819 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 366031..366498 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 366626..367288 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 367473..367739 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 367726..367971 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 368067..368861 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 368964..369092 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 369153..369335 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 369551..370555 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 370708..371067 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 371340..371573 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 371841..372347 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 372504..372890 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ80_RS20515 | 362894..363100 | + | 207 | Protein_348 | DUF3709 domain-containing protein | - |
ASZ80_RS20520 | 363300..363401 | + | 102 | WP_001921603.1 | hypothetical protein | - |
ASZ80_RS16075 | 363391..363777 | + | 387 | WP_000703163.1 | VOC family protein | - |
ASZ80_RS16080 | 363972..364223 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
ASZ80_RS16085 | 364196..364345 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
ASZ80_RS16090 | 364437..364679 | + | 243 | WP_000107461.1 | hypothetical protein | - |
ASZ80_RS16095 | 364931..365209 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
ASZ80_RS20950 | 365584..365727 | + | 144 | Protein_355 | DUF645 family protein | - |
ASZ80_RS20955 | 365781..365819 | + | 39 | WP_082798268.1 | hypothetical protein | - |
ASZ80_RS16110 | 366031..366498 | + | 468 | WP_001289288.1 | OsmC family protein | - |
ASZ80_RS16115 | 366626..367288 | + | 663 | WP_000960654.1 | hypothetical protein | - |
ASZ80_RS16120 | 367473..367739 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
ASZ80_RS16125 | 367726..367971 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
ASZ80_RS16130 | 368067..368861 | + | 795 | WP_001911581.1 | hypothetical protein | - |
ASZ80_RS20960 | 368964..369092 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
ASZ80_RS16145 | 369153..369335 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
ASZ80_RS16150 | 369551..370555 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
ASZ80_RS16155 | 370708..371067 | + | 360 | WP_001071541.1 | VOC family protein | - |
ASZ80_RS16160 | 371340..371573 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
ASZ80_RS16165 | 371841..372347 | + | 507 | WP_000393074.1 | hypothetical protein | - |
ASZ80_RS16170 | 372504..372890 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304694..469286 | 164592 | |
inside | Integron | - | - | 309774..468910 | 159136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T58221 WP_000589156.1 NZ_CP013302:367473-367739 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T58221 NZ_CP013302:367473-367739 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT58221 WP_000643598.1 NZ_CP013302:367726-367971 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT58221 NZ_CP013302:367726-367971 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |