294407

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 217612..218378 Replicon chromosome
Accession NZ_LT992493
Organism Vibrio cholerae strain 4295STDY6534248

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag DG169_RS15430 Protein ID WP_000982260.1
Coordinates 217612..218109 (-) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag DG169_RS15435 Protein ID WP_000246253.1
Coordinates 218106..218378 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG169_RS15370 213054..213758 + 705 WP_000087610.1 HNH endonuclease -
DG169_RS15375 213916..214254 + 339 WP_000713853.1 hypothetical protein -
DG169_RS15385 214408..214725 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG169_RS15390 214744..214986 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG169_RS15395 215230..215616 + 387 WP_001015867.1 NUDIX hydrolase -
DG169_RS15400 215673..215786 + 114 WP_001900214.1 hypothetical protein -
DG169_RS15405 215735..216016 + 282 WP_001894429.1 DUF1289 domain-containing protein -
DG169_RS15420 216274..216810 + 537 WP_000469482.1 GNAT family N-acetyltransferase -
DG169_RS15425 216947..217462 + 516 WP_001201509.1 lipocalin family protein -
DG169_RS15430 217612..218109 - 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
DG169_RS15435 218106..218378 - 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
DG169_RS15440 218771..218896 + 126 WP_001900195.1 DUF645 family protein -
DG169_RS15445 218912..218950 + 39 WP_106019118.1 hypothetical protein -
DG169_RS15455 219146..219592 + 447 WP_000006157.1 hypothetical protein -
DG169_RS15460 219740..220009 - 270 WP_000277238.1 type II toxin-antitoxin system YafQ family toxin -
DG169_RS15465 220002..220280 - 279 WP_001258569.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
DG169_RS15475 220566..220844 + 279 WP_001921601.1 DUF3709 domain-containing protein -
DG169_RS15480 221096..221302 + 207 Protein_208 DUF3709 domain-containing protein -
DG169_RS15485 221502..221603 + 102 WP_001921603.1 hypothetical protein -
DG169_RS15490 221593..221979 + 387 WP_000703163.1 VOC family protein -
DG169_RS15495 222174..222425 + 252 WP_001890111.1 TIGR03643 family protein -
DG169_RS15500 222398..222547 + 150 WP_071908333.1 DUF3265 domain-containing protein -
DG169_RS15505 222639..222881 + 243 WP_000107461.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 197768..293032 95264
inside Integron catB9 - 202848..292656 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T294407 WP_000982260.1 NZ_LT992493:c218109-217612 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT294407 WP_000246253.1 NZ_LT992493:c218378-218106 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References