Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 217612..218378 | Replicon | chromosome |
Accession | NZ_LT992493 | ||
Organism | Vibrio cholerae strain 4295STDY6534248 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9K2P7 |
Locus tag | DG169_RS15430 | Protein ID | WP_000982260.1 |
Coordinates | 217612..218109 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9K2J6 |
Locus tag | DG169_RS15435 | Protein ID | WP_000246253.1 |
Coordinates | 218106..218378 (-) | Length | 91 a.a. |
Genomic Context
Location: 213054..213758 (705 bp)
Type: Others
Protein ID: WP_000087610.1
Type: Others
Protein ID: WP_000087610.1
Location: 213916..214254 (339 bp)
Type: Others
Protein ID: WP_000713853.1
Type: Others
Protein ID: WP_000713853.1
Location: 215230..215616 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 215673..215786 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 215735..216016 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 216274..216810 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 216947..217462 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 218771..218896 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 218912..218950 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 219146..219592 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 220566..220844 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 221096..221302 (207 bp)
Type: Others
Protein ID: Protein_208
Type: Others
Protein ID: Protein_208
Location: 221502..221603 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 221593..221979 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 222174..222425 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 222398..222547 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 222639..222881 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 214408..214725 (318 bp)
Type: Others
Protein ID: WP_001180243.1
Type: Others
Protein ID: WP_001180243.1
Location: 214744..214986 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 217612..218109 (498 bp)
Type: Toxin
Protein ID: WP_000982260.1
Type: Toxin
Protein ID: WP_000982260.1
Location: 218106..218378 (273 bp)
Type: Antitoxin
Protein ID: WP_000246253.1
Type: Antitoxin
Protein ID: WP_000246253.1
Location: 219740..220009 (270 bp)
Type: Others
Protein ID: WP_000277238.1
Type: Others
Protein ID: WP_000277238.1
Location: 220002..220280 (279 bp)
Type: Others
Protein ID: WP_001258569.1
Type: Others
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG169_RS15370 | 213054..213758 | + | 705 | WP_000087610.1 | HNH endonuclease | - |
DG169_RS15375 | 213916..214254 | + | 339 | WP_000713853.1 | hypothetical protein | - |
DG169_RS15385 | 214408..214725 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
DG169_RS15390 | 214744..214986 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
DG169_RS15395 | 215230..215616 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
DG169_RS15400 | 215673..215786 | + | 114 | WP_001900214.1 | hypothetical protein | - |
DG169_RS15405 | 215735..216016 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
DG169_RS15420 | 216274..216810 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
DG169_RS15425 | 216947..217462 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
DG169_RS15430 | 217612..218109 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | Toxin |
DG169_RS15435 | 218106..218378 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | Antitoxin |
DG169_RS15440 | 218771..218896 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
DG169_RS15445 | 218912..218950 | + | 39 | WP_106019118.1 | hypothetical protein | - |
DG169_RS15455 | 219146..219592 | + | 447 | WP_000006157.1 | hypothetical protein | - |
DG169_RS15460 | 219740..220009 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | - |
DG169_RS15465 | 220002..220280 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
DG169_RS15475 | 220566..220844 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
DG169_RS15480 | 221096..221302 | + | 207 | Protein_208 | DUF3709 domain-containing protein | - |
DG169_RS15485 | 221502..221603 | + | 102 | WP_001921603.1 | hypothetical protein | - |
DG169_RS15490 | 221593..221979 | + | 387 | WP_000703163.1 | VOC family protein | - |
DG169_RS15495 | 222174..222425 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
DG169_RS15500 | 222398..222547 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
DG169_RS15505 | 222639..222881 | + | 243 | WP_000107461.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 197768..293032 | 95264 | |
inside | Integron | catB9 | - | 202848..292656 | 89808 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18527.18 Da Isoelectric Point: 8.7753
>T294407 WP_000982260.1 NZ_LT992493:c218109-217612 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0KGB1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 1Y9B | |
AlphaFold DB | A0A0F2IC79 |