Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 295424..295964 | Replicon | chromosome |
Accession | NZ_AP024554 | ||
Organism | Vibrio cholerae strain IDH-03329 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | K6J80_RS15510 | Protein ID | WP_000277238.1 |
Coordinates | 295695..295964 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | K6J80_RS15505 | Protein ID | WP_001258569.1 |
Coordinates | 295424..295702 (+) | Length | 93 a.a. |
Genomic Context
Location: 295424..295702 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Location: 295695..295964 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 297326..297598 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 297595..298092 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 300718..300960 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 291004..291471 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 291643..291774 (132 bp)
Type: Others
Protein ID: WP_001883067.1
Type: Others
Protein ID: WP_001883067.1
Location: 292293..292571 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 292823..293065 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 293157..293306 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 293279..293530 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 293725..294111 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 294101..294202 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 294402..294500 (99 bp)
Type: Others
Protein ID: WP_223225486.1
Type: Others
Protein ID: WP_223225486.1
Location: 294860..295138 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 295256..295373 (118 bp)
Type: Others
Protein ID: Protein_348
Type: Others
Protein ID: Protein_348
Location: 296112..296558 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 296808..296933 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 298109..298177 (69 bp)
Type: Others
Protein ID: Protein_355
Type: Others
Protein ID: Protein_355
Location: 298242..298703 (462 bp)
Type: Others
Protein ID: WP_001903091.1
Type: Others
Protein ID: WP_001903091.1
Location: 298894..299430 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 299688..299909 (222 bp)
Type: Others
Protein ID: WP_032467793.1
Type: Others
Protein ID: WP_032467793.1
Location: 299918..300031 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 300088..300474 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J80_RS15455 | 291004..291471 | - | 468 | WP_001289288.1 | OsmC family protein | - |
K6J80_RS19080 | 291643..291774 | - | 132 | WP_001883067.1 | hypothetical protein | - |
K6J80_RS15470 | 292293..292571 | - | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
K6J80_RS15475 | 292823..293065 | - | 243 | WP_000107461.1 | hypothetical protein | - |
K6J80_RS19085 | 293157..293306 | - | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
K6J80_RS15480 | 293279..293530 | - | 252 | WP_001890111.1 | TIGR03643 family protein | - |
K6J80_RS15485 | 293725..294111 | - | 387 | WP_000703163.1 | VOC family protein | - |
K6J80_RS15490 | 294101..294202 | - | 102 | WP_001921603.1 | hypothetical protein | - |
K6J80_RS19090 | 294402..294500 | - | 99 | WP_223225486.1 | DUF3709 domain-containing protein | - |
K6J80_RS15500 | 294860..295138 | - | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
K6J80_RS19095 | 295256..295373 | - | 118 | Protein_348 | DUF3265 domain-containing protein | - |
K6J80_RS15505 | 295424..295702 | + | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
K6J80_RS15510 | 295695..295964 | + | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
K6J80_RS15515 | 296112..296558 | - | 447 | WP_000006157.1 | hypothetical protein | - |
K6J80_RS15525 | 296808..296933 | - | 126 | WP_001900195.1 | DUF645 family protein | - |
K6J80_RS15530 | 297326..297598 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
K6J80_RS15535 | 297595..298092 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
K6J80_RS19100 | 298109..298177 | - | 69 | Protein_355 | acetyltransferase | - |
K6J80_RS15540 | 298242..298703 | - | 462 | WP_001903091.1 | lipocalin family protein | - |
K6J80_RS15545 | 298894..299430 | - | 537 | WP_000469482.1 | GNAT family protein | - |
K6J80_RS15550 | 299688..299909 | - | 222 | WP_032467793.1 | DUF1289 domain-containing protein | - |
K6J80_RS15555 | 299918..300031 | - | 114 | WP_001900214.1 | hypothetical protein | - |
K6J80_RS15560 | 300088..300474 | - | 387 | WP_001015867.1 | NUDIX hydrolase | - |
K6J80_RS15565 | 300718..300960 | + | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 213119..319686 | 106567 | |
inside | Integron | - | - | 213119..312856 | 99737 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T38682 WP_000277238.1 NZ_AP024554:295695-295964 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T38682 NZ_AP024554:295695-295964 [Vibrio cholerae]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT38682 WP_001258569.1 NZ_AP024554:295424-295702 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT38682 NZ_AP024554:295424-295702 [Vibrio cholerae]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |