Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 367520..368018 | Replicon | chromosome |
Accession | NZ_CP013306 | ||
Organism | Vibrio cholerae strain CRC1106 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | ASZ81_RS16145 | Protein ID | WP_000589156.1 |
Coordinates | 367520..367786 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | ASZ81_RS16150 | Protein ID | WP_000643598.1 |
Coordinates | 367773..368018 (+) | Length | 82 a.a. |
Genomic Context
Location: 362941..363147 (207 bp)
Type: Others
Protein ID: Protein_347
Type: Others
Protein ID: Protein_347
Location: 363347..363448 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 363438..363824 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 364019..364270 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 364243..364392 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 364484..364726 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 364978..365256 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 365631..365774 (144 bp)
Type: Others
Protein ID: Protein_354
Type: Others
Protein ID: Protein_354
Location: 365828..365866 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 366078..366545 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 366673..367335 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 367520..367786 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 367773..368018 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 368114..368908 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 369011..369139 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 369200..369382 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 369598..370602 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 370755..371114 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 371387..371620 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 371888..372394 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 372551..372937 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ81_RS20510 | 362941..363147 | + | 207 | Protein_347 | DUF3709 domain-containing protein | - |
ASZ81_RS20515 | 363347..363448 | + | 102 | WP_001921603.1 | hypothetical protein | - |
ASZ81_RS16100 | 363438..363824 | + | 387 | WP_000703163.1 | VOC family protein | - |
ASZ81_RS16105 | 364019..364270 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
ASZ81_RS16110 | 364243..364392 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
ASZ81_RS16115 | 364484..364726 | + | 243 | WP_000107461.1 | hypothetical protein | - |
ASZ81_RS16120 | 364978..365256 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
ASZ81_RS20920 | 365631..365774 | + | 144 | Protein_354 | DUF645 family protein | - |
ASZ81_RS20925 | 365828..365866 | + | 39 | WP_082798268.1 | hypothetical protein | - |
ASZ81_RS16135 | 366078..366545 | + | 468 | WP_001289288.1 | OsmC family protein | - |
ASZ81_RS16140 | 366673..367335 | + | 663 | WP_000960654.1 | hypothetical protein | - |
ASZ81_RS16145 | 367520..367786 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
ASZ81_RS16150 | 367773..368018 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
ASZ81_RS16155 | 368114..368908 | + | 795 | WP_001911581.1 | hypothetical protein | - |
ASZ81_RS20930 | 369011..369139 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
ASZ81_RS16170 | 369200..369382 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
ASZ81_RS16175 | 369598..370602 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
ASZ81_RS16180 | 370755..371114 | + | 360 | WP_001071541.1 | VOC family protein | - |
ASZ81_RS16185 | 371387..371620 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
ASZ81_RS16190 | 371888..372394 | + | 507 | WP_000393074.1 | hypothetical protein | - |
ASZ81_RS16195 | 372551..372937 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304741..463550 | 158809 | |
inside | Integron | - | - | 309821..463174 | 153353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T58266 WP_000589156.1 NZ_CP013306:367520-367786 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T58266 NZ_CP013306:367520-367786 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT58266 WP_000643598.1 NZ_CP013306:367773-368018 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT58266 NZ_CP013306:367773-368018 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |