Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 332886..333424 | Replicon | chromosome |
Accession | NZ_CP013314 | ||
Organism | Vibrio cholerae strain E9120 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | ASZ79_RS15725 | Protein ID | WP_000802136.1 |
Coordinates | 332886..333185 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | ASZ79_RS15730 | Protein ID | WP_001107719.1 |
Coordinates | 333182..333424 (-) | Length | 81 a.a. |
Genomic Context
Location: 328091..328273 (183 bp)
Type: Others
Protein ID: WP_000923340.1
Type: Others
Protein ID: WP_000923340.1
Location: 328488..329027 (540 bp)
Type: Others
Protein ID: WP_000099372.1
Type: Others
Protein ID: WP_000099372.1
Location: 329150..329665 (516 bp)
Type: Others
Protein ID: WP_000090011.1
Type: Others
Protein ID: WP_000090011.1
Location: 329800..330336 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 330805..330915 (111 bp)
Type: Others
Protein ID: WP_071908335.1
Type: Others
Protein ID: WP_071908335.1
Location: 331128..331280 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 331564..332007 (444 bp)
Type: Others
Protein ID: WP_000803902.1
Type: Others
Protein ID: WP_000803902.1
Location: 332011..332121 (111 bp)
Type: Others
Protein ID: WP_071908336.1
Type: Others
Protein ID: WP_071908336.1
Location: 333843..333920 (78 bp)
Type: Others
Protein ID: WP_071908337.1
Type: Others
Protein ID: WP_071908337.1
Location: 333924..333950 (27 bp)
Type: Others
Protein ID: Protein_298
Type: Others
Protein ID: Protein_298
Location: 334536..334679 (144 bp)
Type: Others
Protein ID: WP_001900215.1
Type: Others
Protein ID: WP_001900215.1
Location: 334773..334952 (180 bp)
Type: Others
Protein ID: Protein_300
Type: Others
Protein ID: Protein_300
Location: 335170..335598 (429 bp)
Type: Others
Protein ID: WP_000620002.1
Type: Others
Protein ID: WP_000620002.1
Location: 336186..336668 (483 bp)
Type: Others
Protein ID: WP_000422940.1
Type: Others
Protein ID: WP_000422940.1
Location: 337476..337745 (270 bp)
Type: Others
Protein ID: WP_001114075.1
Type: Others
Protein ID: WP_001114075.1
Location: 337739..338260 (522 bp)
Type: Others
Protein ID: WP_000921692.1
Type: Others
Protein ID: WP_000921692.1
Location: 332151..332429 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 332426..332710 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Location: 332886..333185 (300 bp)
Type: Toxin
Protein ID: WP_000802136.1
Type: Toxin
Protein ID: WP_000802136.1
Location: 333182..333424 (243 bp)
Type: Antitoxin
Protein ID: WP_001107719.1
Type: Antitoxin
Protein ID: WP_001107719.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ79_RS15665 | 328091..328273 | + | 183 | WP_000923340.1 | DUF645 family protein | - |
ASZ79_RS15670 | 328488..329027 | + | 540 | WP_000099372.1 | hypothetical protein | - |
ASZ79_RS15675 | 329150..329665 | + | 516 | WP_000090011.1 | hypothetical protein | - |
ASZ79_RS15680 | 329800..330336 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
ASZ79_RS15685 | 330805..330915 | + | 111 | WP_071908335.1 | DUF3265 domain-containing protein | - |
ASZ79_RS15695 | 331128..331280 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
ASZ79_RS15700 | 331564..332007 | + | 444 | WP_000803902.1 | hypothetical protein | - |
ASZ79_RS15705 | 332011..332121 | + | 111 | WP_071908336.1 | DUF3265 domain-containing protein | - |
ASZ79_RS15710 | 332151..332429 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
ASZ79_RS15715 | 332426..332710 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
ASZ79_RS15725 | 332886..333185 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ79_RS15730 | 333182..333424 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
ASZ79_RS15740 | 333843..333920 | + | 78 | WP_071908337.1 | DUF645 family protein | - |
ASZ79_RS20905 | 333924..333950 | + | 27 | Protein_298 | hypothetical protein | - |
ASZ79_RS20985 | 334536..334679 | + | 144 | WP_001900215.1 | hypothetical protein | - |
ASZ79_RS20480 | 334773..334952 | + | 180 | Protein_300 | DUF645 family protein | - |
ASZ79_RS15765 | 335170..335598 | + | 429 | WP_000620002.1 | N-acetyltransferase | - |
ASZ79_RS15775 | 336186..336668 | + | 483 | WP_000422940.1 | GNAT family N-acetyltransferase | - |
ASZ79_RS15785 | 337476..337745 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | - |
ASZ79_RS15790 | 337739..338260 | + | 522 | WP_000921692.1 | DUF2442 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304700..468464 | 163764 | |
inside | Integron | - | - | 309780..468088 | 158308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T58350 WP_000802136.1 NZ_CP013314:c333185-332886 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T58350 NZ_CP013314:c333185-332886 [Vibrio cholerae]
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCCGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCCGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT58350 WP_001107719.1 NZ_CP013314:c333424-333182 [Vibrio cholerae]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT58350 NZ_CP013314:c333424-333182 [Vibrio cholerae]
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A | |
PDB | 7B22 | |
AlphaFold DB | A0A151JFU4 |