Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 399756..400303 | Replicon | chromosome |
Accession | NZ_CP009041 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain FJ147 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9KM92 |
Locus tag | IR04_RS02045 | Protein ID | WP_000229317.1 |
Coordinates | 400001..400303 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | IR04_RS02040 | Protein ID | WP_000861987.1 |
Coordinates | 399756..400013 (+) | Length | 86 a.a. |
Genomic Context
Location: 394785..395240 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 395562..395714 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 396913..397581 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 397733..398020 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 398161..398532 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 398599..399024 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 399021..399554 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 399756..400013 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 400001..400303 (303 bp)
Type: Toxin
Protein ID: WP_000229317.1
Type: Toxin
Protein ID: WP_000229317.1
Location: 400537..401454 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 401611..402000 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 402136..402345 (210 bp)
Type: Others
Protein ID: Protein_424
Type: Others
Protein ID: Protein_424
Location: 402464..402901 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 402965..403183 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 403358..404230 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 404380..404979 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 405036..405140 (105 bp)
Type: Others
Protein ID: WP_099607150.1
Type: Others
Protein ID: WP_099607150.1
Location: 395916..396413 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 396410..396682 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IR04_RS01995 | 394785..395240 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
IR04_RS02000 | 395562..395714 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
IR04_RS02005 | 395916..396413 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
IR04_RS02010 | 396410..396682 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
IR04_RS02015 | 396913..397581 | + | 669 | WP_000043871.1 | hypothetical protein | - |
IR04_RS02020 | 397733..398020 | + | 288 | WP_000426470.1 | hypothetical protein | - |
IR04_RS02025 | 398161..398532 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
IR04_RS02030 | 398599..399024 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
IR04_RS02035 | 399021..399554 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
IR04_RS02040 | 399756..400013 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
IR04_RS02045 | 400001..400303 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
IR04_RS02050 | 400537..401454 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
IR04_RS02055 | 401611..402000 | + | 390 | WP_001081302.1 | hypothetical protein | - |
IR04_RS02060 | 402136..402345 | + | 210 | Protein_424 | GNAT family N-acetyltransferase | - |
IR04_RS02065 | 402464..402901 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
IR04_RS02070 | 402965..403183 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
IR04_RS02075 | 403358..404230 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
IR04_RS02080 | 404380..404979 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
IR04_RS20045 | 405036..405140 | + | 105 | WP_099607150.1 | acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304700..409892 | 105192 | |
inside | Integron | - | - | 309780..409516 | 99736 | ||
flank | IS/Tn | - | - | 402464..402901 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T48159 WP_000229317.1 NZ_CP009041:400001-400303 [Vibrio cholerae O1 biovar El Tor]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T48159 NZ_CP009041:400001-400303 [Vibrio cholerae O1 biovar El Tor]
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
Antitoxin
Download Length: 86 a.a. Molecular weight: 9647.15 Da Isoelectric Point: 7.3178
>AT48159 WP_000861987.1 NZ_CP009041:399756-400013 [Vibrio cholerae O1 biovar El Tor]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
Download Length: 258 bp
>AT48159 NZ_CP009041:399756-400013 [Vibrio cholerae O1 biovar El Tor]
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM92 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |