Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 45408..45967 | Replicon | chromosome |
Accession | NZ_AP024548 | ||
Organism | Vibrio cholerae strain BCH-01536 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9K2M8 |
Locus tag | K6J77_RS14205 | Protein ID | WP_000578476.1 |
Coordinates | 45408..45686 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9L991 |
Locus tag | K6J77_RS14210 | Protein ID | WP_000381183.1 |
Coordinates | 45683..45967 (-) | Length | 95 a.a. |
Genomic Context
Location: 40486..40992 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 41149..41535 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 41792..41995 (204 bp)
Type: Others
Protein ID: WP_001911580.1
Type: Others
Protein ID: WP_001911580.1
Location: 42190..42441 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 42414..42563 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 42710..43135 (426 bp)
Type: Others
Protein ID: WP_000415750.1
Type: Others
Protein ID: WP_000415750.1
Location: 43341..43964 (624 bp)
Type: Others
Protein ID: WP_000247070.1
Type: Others
Protein ID: WP_000247070.1
Location: 44177..44656 (480 bp)
Type: Others
Protein ID: WP_000009888.1
Type: Others
Protein ID: WP_000009888.1
Location: 44653..44769 (117 bp)
Type: Others
Protein ID: WP_086010882.1
Type: Others
Protein ID: WP_086010882.1
Location: 44844..45257 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 46216..46677 (462 bp)
Type: Others
Protein ID: WP_001911578.1
Type: Others
Protein ID: WP_001911578.1
Location: 46742..47338 (597 bp)
Type: Others
Protein ID: WP_000255434.1
Type: Others
Protein ID: WP_000255434.1
Location: 47532..47669 (138 bp)
Type: Others
Protein ID: WP_001890145.1
Type: Others
Protein ID: WP_001890145.1
Location: 47730..47912 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 48112..48585 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 48600..48692 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 48734..49360 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 49483..50181 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 50212..50301 (90 bp)
Type: Others
Protein ID: WP_072606010.1
Type: Others
Protein ID: WP_072606010.1
Location: 45408..45686 (279 bp)
Type: Toxin
Protein ID: WP_000578476.1
Type: Toxin
Protein ID: WP_000578476.1
Location: 45683..45967 (285 bp)
Type: Antitoxin
Protein ID: WP_000381183.1
Type: Antitoxin
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J77_RS14165 | 40486..40992 | + | 507 | WP_000393074.1 | hypothetical protein | - |
K6J77_RS14170 | 41149..41535 | + | 387 | WP_000703163.1 | VOC family protein | - |
K6J77_RS14175 | 41792..41995 | + | 204 | WP_001911580.1 | hypothetical protein | - |
K6J77_RS14180 | 42190..42441 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
K6J77_RS18995 | 42414..42563 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
K6J77_RS14185 | 42710..43135 | + | 426 | WP_000415750.1 | hypothetical protein | - |
K6J77_RS14190 | 43341..43964 | + | 624 | WP_000247070.1 | DUF1349 domain-containing protein | - |
K6J77_RS14195 | 44177..44656 | + | 480 | WP_000009888.1 | lecithin retinol acyltransferase family protein | - |
K6J77_RS19000 | 44653..44769 | + | 117 | WP_086010882.1 | DUF3265 domain-containing protein | - |
K6J77_RS14200 | 44844..45257 | + | 414 | WP_000049420.1 | VOC family protein | - |
K6J77_RS14205 | 45408..45686 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
K6J77_RS14210 | 45683..45967 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
K6J77_RS14215 | 46216..46677 | + | 462 | WP_001911578.1 | lipocalin family protein | - |
K6J77_RS14220 | 46742..47338 | + | 597 | WP_000255434.1 | hypothetical protein | - |
K6J77_RS19005 | 47532..47669 | + | 138 | WP_001890145.1 | hypothetical protein | - |
K6J77_RS14225 | 47730..47912 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
K6J77_RS14230 | 48112..48585 | + | 474 | WP_001161076.1 | GrpB family protein | - |
K6J77_RS14235 | 48600..48692 | + | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
K6J77_RS14240 | 48734..49360 | + | 627 | WP_000365424.1 | LysE family translocator | - |
K6J77_RS14245 | 49483..50181 | + | 699 | WP_001890502.1 | hypothetical protein | - |
K6J77_RS14250 | 50212..50301 | + | 90 | WP_072606010.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Integron | - | - | 11978..113648 | 101670 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10819.59 Da Isoelectric Point: 5.1651
>T38620 WP_000578476.1 NZ_AP024548:c45686-45408 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND
Download Length: 279 bp
>T38620 NZ_AP024548:c45686-45408 [Vibrio cholerae]
ATGATTTTCTGGGAAGAAGCATCTCTCAATGATCGTGAGAAAATTTTCGAATTTCTCTACGACTTTAACCCAGCAGCGGC
TAAAAAAACGGATGAGCTCATAGAAGCCAAAGTCGAAAATTTGCTTGAGCAACCACTAATCGGTGTTCAGCGTGATGGCA
TTAGAGGCAGATTGCTTATTATCCCTGAGATATCAATGATTGTTTCGTATTGGGTTGATGGTTCTAAAATTCGAATAATG
CGTGTACTACATCAGAAACAAAAATTTCCAAACGACTGA
ATGATTTTCTGGGAAGAAGCATCTCTCAATGATCGTGAGAAAATTTTCGAATTTCTCTACGACTTTAACCCAGCAGCGGC
TAAAAAAACGGATGAGCTCATAGAAGCCAAAGTCGAAAATTTGCTTGAGCAACCACTAATCGGTGTTCAGCGTGATGGCA
TTAGAGGCAGATTGCTTATTATCCCTGAGATATCAATGATTGTTTCGTATTGGGTTGATGGTTCTAAAATTCGAATAATG
CGTGTACTACATCAGAAACAAAAATTTCCAAACGACTGA
Antitoxin
Download Length: 95 a.a. Molecular weight: 10901.25 Da Isoelectric Point: 8.0775
>AT38620 WP_000381183.1 NZ_AP024548:c45967-45683 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
Download Length: 285 bp
>AT38620 NZ_AP024548:c45967-45683 [Vibrio cholerae]
ATGGATACTAGAATTCAATTTCGTGTAGACGAAGAAACAAAACGTTTAGCTCAACAAATGGCTGAAAGCCAAGGTCGAAC
TCTTAGCGATGCTTGCCGTGAACTCACTGAACAATTAGCTGAGCAGCAACGCAAGGCATTATCTCACGATGCATGGCTAA
CTGAACAAGTGAATCAAGCATTTGAGAAGTTCGACTCAGGAAAAGCAGTATTCATTGAACATGACATCGCCAAAGCACGA
ATGGCTGAACGTAAAGCTAAAATCCGAAATCGAGGCCACGCATGA
ATGGATACTAGAATTCAATTTCGTGTAGACGAAGAAACAAAACGTTTAGCTCAACAAATGGCTGAAAGCCAAGGTCGAAC
TCTTAGCGATGCTTGCCGTGAACTCACTGAACAATTAGCTGAGCAGCAACGCAAGGCATTATCTCACGATGCATGGCTAA
CTGAACAAGTGAATCAAGCATTTGAGAAGTTCGACTCAGGAAAAGCAGTATTCATTGAACATGACATCGCCAAAGCACGA
ATGGCTGAACGTAAAGCTAAAATCCGAAATCGAGGCCACGCATGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9K2M8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A067BL33 |