Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 333921..334419 | Replicon | chromosome II |
Accession | NC_016945 | ||
Organism | Vibrio cholerae IEC224 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | O3Y_RS15525 | Protein ID | WP_000589156.1 |
Coordinates | 333921..334187 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | O3Y_RS15530 | Protein ID | WP_000643598.1 |
Coordinates | 334174..334419 (+) | Length | 82 a.a. |
Genomic Context
Location: 329341..329547 (207 bp)
Type: Others
Protein ID: Protein_292
Type: Others
Protein ID: Protein_292
Location: 329747..329848 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 329838..330224 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 330419..330670 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 330643..330792 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 330884..331126 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 331378..331656 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 332031..332174 (144 bp)
Type: Others
Protein ID: Protein_299
Type: Others
Protein ID: Protein_299
Location: 332228..332266 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 332478..332945 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 333073..333736 (664 bp)
Type: Others
Protein ID: Protein_302
Type: Others
Protein ID: Protein_302
Location: 333921..334187 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 334174..334419 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 334515..335309 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 335412..335540 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 335601..335783 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 335999..337003 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 337156..337515 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 337788..338021 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 338289..338795 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 338952..339338 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3Y_RS20160 | 329341..329547 | + | 207 | Protein_292 | DUF3709 domain-containing protein | - |
O3Y_RS20165 | 329747..329848 | + | 102 | WP_001921603.1 | hypothetical protein | - |
O3Y_RS15490 | 329838..330224 | + | 387 | WP_000703163.1 | VOC family protein | - |
O3Y_RS15495 | 330419..330670 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
O3Y_RS19635 | 330643..330792 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
O3Y_RS15500 | 330884..331126 | + | 243 | WP_000107461.1 | hypothetical protein | - |
O3Y_RS15505 | 331378..331656 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
O3Y_RS20580 | 332031..332174 | + | 144 | Protein_299 | DUF645 family protein | - |
O3Y_RS20585 | 332228..332266 | + | 39 | WP_082798268.1 | hypothetical protein | - |
O3Y_RS15515 | 332478..332945 | + | 468 | WP_001289288.1 | OsmC family protein | - |
O3Y_RS15520 | 333073..333736 | + | 664 | Protein_302 | hypothetical protein | - |
O3Y_RS15525 | 333921..334187 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
O3Y_RS15530 | 334174..334419 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
O3Y_RS15535 | 334515..335309 | + | 795 | WP_001911581.1 | hypothetical protein | - |
O3Y_RS20590 | 335412..335540 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
O3Y_RS15540 | 335601..335783 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
O3Y_RS15545 | 335999..337003 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
O3Y_RS15550 | 337156..337515 | + | 360 | WP_001071541.1 | VOC family protein | - |
O3Y_RS15555 | 337788..338021 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
O3Y_RS15560 | 338289..338795 | + | 507 | WP_000393074.1 | hypothetical protein | - |
O3Y_RS15565 | 338952..339338 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304637..435582 | 130945 | |
inside | Integron | - | - | 309717..435206 | 125489 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T26146 WP_000589156.1 NC_016945:333921-334187 [Vibrio cholerae IEC224]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T26146 NC_016945:333921-334187 [Vibrio cholerae IEC224]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT26146 WP_000643598.1 NC_016945:334174-334419 [Vibrio cholerae IEC224]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT26146 NC_016945:334174-334419 [Vibrio cholerae IEC224]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |