254473

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 783889..784417 Replicon chromosome
Accession NZ_CP102928
Organism Vibrio cholerae strain N1252

Toxin (Protein)


Gene name relE Uniprot ID H9L4R3
Locus tag NW313_RS17655 Protein ID WP_000221352.1
Coordinates 783889..784179 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID H9L4T4
Locus tag NW313_RS17660 Protein ID WP_000213183.1
Coordinates 784169..784417 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW313_RS17605 779159..779269 + 111 WP_134814058.1 DUF3265 domain-containing protein -
NW313_RS17610 779308..779418 + 111 Protein_745 acetyltransferase -
NW313_RS17615 779446..779571 + 126 WP_001944767.1 DUF645 family protein -
NW313_RS17620 779534..779650 + 117 WP_001889170.1 hypothetical protein -
NW313_RS17625 779838..780842 + 1005 WP_000964925.1 LD-carboxypeptidase -
NW313_RS17630 780995..781441 + 447 WP_000128977.1 hypothetical protein -
NW313_RS17635 781561..782490 + 930 WP_000335802.1 hypothetical protein -
NW313_RS17640 782487..782597 + 111 WP_071917832.1 DUF3265 domain-containing protein -
NW313_RS17645 782625..783101 + 477 WP_001047171.1 GNAT family N-acetyltransferase -
NW313_RS17650 783292..783753 + 462 WP_001911752.1 lipocalin family protein -
NW313_RS17655 783889..784179 - 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NW313_RS17660 784169..784417 - 249 WP_000213183.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NW313_RS17665 784988..785641 + 654 WP_000036957.1 site-specific DNA-methyltransferase -
NW313_RS17670 785913..786338 + 426 WP_000415748.1 hypothetical protein -
NW313_RS17675 786546..786941 + 396 WP_000649527.1 DUF3465 domain-containing protein -
NW313_RS17680 787092..787622 + 531 WP_000415563.1 hypothetical protein -
NW313_RS17685 787760..788260 + 501 WP_000789723.1 hypothetical protein -
NW313_RS17690 788416..788814 + 399 WP_001882293.1 hypothetical protein -
NW313_RS17695 788914..789378 - 465 WP_000140244.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 713852..820357 106505
inside Integron catB9 - 718932..819981 101049


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11247.23 Da        Isoelectric Point: 10.4678

>T254473 WP_000221352.1 NZ_CP102928:c784179-783889 [Vibrio cholerae]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8937.28 Da        Isoelectric Point: 4.1079

>AT254473 WP_000213183.1 NZ_CP102928:c784417-784169 [Vibrio cholerae]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKERLSEDSVSVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H9L4R3

Antitoxin

Source ID Structure
AlphaFold DB A0A366A3W8

References