293828

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 369423..370038 Replicon chromosome
Accession NZ_LT907990
Organism Vibrio cholerae strain A19

Toxin (Protein)


Gene name higB Uniprot ID Q9KMG5
Locus tag ALC86_RS15870 Protein ID WP_001162670.1
Coordinates 369423..369710 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag ALC86_RS15875 Protein ID WP_001232701.1
Coordinates 369721..370038 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ALC86_RS19730 365059..365154 + 96 WP_001907607.1 DUF645 family protein -
ALC86_RS15830 365348..365665 - 318 WP_001180243.1 type II toxin-antitoxin system RelE/ParE family toxin -
ALC86_RS15835 365684..365926 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
ALC86_RS15840 366168..366677 + 510 WP_000405987.1 GNAT family N-acetyltransferase -
ALC86_RS15845 366734..367387 + 654 WP_000226874.1 hypothetical protein -
ALC86_RS15850 367697..367915 + 219 WP_001917086.1 DUF3709 domain-containing protein -
ALC86_RS15860 368318..368551 + 234 WP_032482776.1 DUF3709 domain-containing protein -
ALC86_RS15865 368976..369156 + 181 Protein_363 DUF645 family protein -
ALC86_RS15870 369423..369710 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ALC86_RS15875 369721..370038 + 318 WP_001232701.1 HigA family addiction module antidote protein Antitoxin
ALC86_RS19735 370035..370145 + 111 WP_134814058.1 DUF3265 domain-containing protein -
ALC86_RS15885 370322..370447 + 126 WP_001944767.1 DUF645 family protein -
ALC86_RS19585 370463..370501 + 39 WP_106019119.1 hypothetical protein -
ALC86_RS15900 370725..371465 + 741 WP_000469836.1 PhzF family phenazine biosynthesis protein -
ALC86_RS15905 371670..372500 + 831 WP_000056616.1 abortive infection family protein -
ALC86_RS15915 372557..373039 + 483 WP_001895003.1 hypothetical protein -
ALC86_RS15925 373486..374361 + 876 WP_000259044.1 hypothetical protein -
ALC86_RS15930 374491..374946 + 456 WP_001245327.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(2-95)

Antitoxin

Cro/C1-type helix-turn-helix domain

(12-69)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11349.95 Da        Isoelectric Point: 6.7187

>T293828 WP_001162670.1 NZ_LT907990:369423-369710 [Vibrio cholerae]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY

Download         Length: 288 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11705.63 Da        Isoelectric Point: 10.4711

>AT293828 WP_001232701.1 NZ_LT907990:369721-370038 [Vibrio cholerae]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0F2HI36

Antitoxin

Source ID Structure

References