Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 369824..370439 | Replicon | chromosome |
Accession | NZ_CP047298 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain C6709 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMG5 |
Locus tag | GTF73_RS15615 | Protein ID | WP_001162670.1 |
Coordinates | 369824..370111 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | GTF73_RS15620 | Protein ID | WP_001232701.1 |
Coordinates | 370122..370439 (+) | Length | 106 a.a. |
Genomic Context
Location: 365460..365555 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 366569..367078 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 367135..367788 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 368098..368316 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 368719..368952 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 369377..369557 (181 bp)
Type: Others
Protein ID: Protein_365
Type: Others
Protein ID: Protein_365
Location: 369824..370111 (288 bp)
Type: Toxin
Protein ID: WP_001162670.1
Type: Toxin
Protein ID: WP_001162670.1
Location: 370122..370439 (318 bp)
Type: Antitoxin
Protein ID: WP_001232701.1
Type: Antitoxin
Protein ID: WP_001232701.1
Location: 370436..370546 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 370723..370848 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 370864..370902 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 371126..371866 (741 bp)
Type: Others
Protein ID: WP_000469836.1
Type: Others
Protein ID: WP_000469836.1
Location: 372071..372901 (831 bp)
Type: Others
Protein ID: WP_000056616.1
Type: Others
Protein ID: WP_000056616.1
Location: 372958..373440 (483 bp)
Type: Others
Protein ID: WP_001895003.1
Type: Others
Protein ID: WP_001895003.1
Location: 373887..374762 (876 bp)
Type: Others
Protein ID: WP_000259044.1
Type: Others
Protein ID: WP_000259044.1
Location: 374892..375347 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 365749..366066 (318 bp)
Type: Others
Protein ID: WP_001180243.1
Type: Others
Protein ID: WP_001180243.1
Location: 366085..366327 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF73_RS15575 | 365460..365555 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
GTF73_RS15580 | 365749..366066 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GTF73_RS15585 | 366085..366327 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GTF73_RS15590 | 366569..367078 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
GTF73_RS15595 | 367135..367788 | + | 654 | WP_000226874.1 | hypothetical protein | - |
GTF73_RS15600 | 368098..368316 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
GTF73_RS15605 | 368719..368952 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
GTF73_RS15610 | 369377..369557 | + | 181 | Protein_365 | DUF645 family protein | - |
GTF73_RS15615 | 369824..370111 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF73_RS15620 | 370122..370439 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | Antitoxin |
GTF73_RS15625 | 370436..370546 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
GTF73_RS15630 | 370723..370848 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
GTF73_RS15635 | 370864..370902 | + | 39 | WP_106019119.1 | hypothetical protein | - |
GTF73_RS15640 | 371126..371866 | + | 741 | WP_000469836.1 | PhzF family phenazine biosynthesis protein | - |
GTF73_RS15645 | 372071..372901 | + | 831 | WP_000056616.1 | abortive infection family protein | - |
GTF73_RS15650 | 372958..373440 | + | 483 | WP_001895003.1 | hypothetical protein | - |
GTF73_RS15655 | 373887..374762 | + | 876 | WP_000259044.1 | hypothetical protein | - |
GTF73_RS15660 | 374892..375347 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306901..436162 | 129261 | |
inside | Integron | - | - | 311981..435786 | 123805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11349.95 Da Isoelectric Point: 6.7187
>T145830 WP_001162670.1 NZ_CP047298:369824-370111 [Vibrio cholerae O1 biovar El Tor]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
Download Length: 288 bp
>T145830 NZ_CP062701:69659-69817 [Escherichia coli O157:H7]
ATGAAACTACCACGCAGCTCTCTTGTCTGGTGTGTGTTGATAGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGCAGCTCTCTTGTCTGGTGTGTGTTGATAGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 106 a.a. Molecular weight: 11705.63 Da Isoelectric Point: 10.4711
>AT145830 WP_001232701.1 NZ_CP047298:370122-370439 [Vibrio cholerae O1 biovar El Tor]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
Download Length: 318 bp
>AT145830 NZ_CP062701:69396-69594 [Escherichia coli O157:H7]
TCACACGGATTGCCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAATGTGGTCAGCGTGCTGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACGGATTGCCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAATGTGGTCAGCGTGCTGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F2HI36 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |