Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 115420..116053 | Replicon | chromosome |
Accession | NZ_CP026648 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain HC1037 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | C4E16_RS15125 | Protein ID | WP_000843587.1 |
Coordinates | 115420..115752 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | C4E16_RS15130 | Protein ID | WP_000071008.1 |
Coordinates | 115739..116053 (+) | Length | 105 a.a. |
Genomic Context
Location: 110861..111064 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 111345..111518 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 111878..112147 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 112465..112636 (172 bp)
Type: Others
Protein ID: Protein_169
Type: Others
Protein ID: Protein_169
Location: 112845..113231 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 113433..113675 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 113846..114223 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 114280..114394 (115 bp)
Type: Others
Protein ID: Protein_173
Type: Others
Protein ID: Protein_173
Location: 114343..114624 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 114790..114903 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 114852..115079 (228 bp)
Type: Others
Protein ID: WP_073426587.1
Type: Others
Protein ID: WP_073426587.1
Location: 115420..115752 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 115739..116053 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 116190..116624 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 116792..116947 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 118120..118426 (307 bp)
Type: Others
Protein ID: Protein_182
Type: Others
Protein ID: Protein_182
Location: 118563..119255 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 119255..119656 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 119626..119769 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 119844..120257 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 120471..120722 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 120712..120999 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 117072..118052 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C4E16_RS19575 | 110861..111064 | + | 204 | WP_001911745.1 | hypothetical protein | - |
C4E16_RS15060 | 111345..111518 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
C4E16_RS15065 | 111878..112147 | + | 270 | WP_001198131.1 | hypothetical protein | - |
C4E16_RS15070 | 112465..112636 | + | 172 | Protein_169 | DUF645 family protein | - |
C4E16_RS15075 | 112845..113231 | + | 387 | WP_000703163.1 | VOC family protein | - |
C4E16_RS15080 | 113433..113675 | + | 243 | WP_000107461.1 | hypothetical protein | - |
C4E16_RS15085 | 113846..114223 | + | 378 | WP_000411109.1 | hypothetical protein | - |
C4E16_RS19580 | 114280..114394 | + | 115 | Protein_173 | acetyltransferase | - |
C4E16_RS15090 | 114343..114624 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
C4E16_RS15105 | 114790..114903 | + | 114 | WP_001889158.1 | hypothetical protein | - |
C4E16_RS15110 | 114852..115079 | + | 228 | WP_073426587.1 | DUF1289 domain-containing protein | - |
C4E16_RS15125 | 115420..115752 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C4E16_RS15130 | 115739..116053 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
C4E16_RS15135 | 116190..116624 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
C4E16_RS19445 | 116792..116947 | + | 156 | WP_000751734.1 | hypothetical protein | - |
C4E16_RS15140 | 117072..118052 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
C4E16_RS15145 | 118120..118426 | + | 307 | Protein_182 | CatB-related O-acetyltransferase | - |
C4E16_RS15150 | 118563..119255 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
C4E16_RS15155 | 119255..119656 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
C4E16_RS15160 | 119626..119769 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
C4E16_RS15165 | 119844..120257 | + | 414 | WP_000049417.1 | VOC family protein | - |
C4E16_RS15170 | 120471..120722 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
C4E16_RS15175 | 120712..120999 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31043..136234 | 105191 | |
inside | Integron | - | - | 36123..135858 | 99735 | ||
flank | IS/Tn | - | - | 117072..118052 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T95384 WP_000843587.1 NZ_CP026648:115420-115752 [Vibrio cholerae O1 biovar El Tor]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T95384 NZ_CP026648:115420-115752 [Vibrio cholerae O1 biovar El Tor]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT95384 WP_000071008.1 NZ_CP026648:115739-116053 [Vibrio cholerae O1 biovar El Tor]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT95384 NZ_CP026648:115739-116053 [Vibrio cholerae O1 biovar El Tor]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA