293836

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) dhiT-phd/-
Location 430905..431309 Replicon chromosome
Accession NZ_LT907990
Organism Vibrio cholerae strain A19

Toxin (Protein)


Gene name dhiT Uniprot ID A0A086SLD6
Locus tag ALC86_RS16565 Protein ID WP_001114075.1
Coordinates 431040..431309 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag ALC86_RS19615 Protein ID WP_099607150.1
Coordinates 430905..431009 (+) Length 35 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ALC86_RS16525 426406..427323 + 918 WP_000186333.1 alpha/beta hydrolase -
ALC86_RS16535 427480..427869 + 390 WP_001081302.1 hypothetical protein -
ALC86_RS16540 428005..428214 + 210 Protein_466 GNAT family N-acetyltransferase -
ALC86_RS16545 428333..428770 + 438 WP_000503169.1 IS200/IS605-like element IS1004 family transposase -
ALC86_RS16550 428834..429052 + 219 WP_071908318.1 GNAT family N-acetyltransferase -
ALC86_RS16555 429227..430099 + 873 WP_000254716.1 DUF3800 domain-containing protein -
ALC86_RS16560 430249..430848 + 600 WP_001891245.1 glutathione S-transferase N-terminal domain-containing protein -
ALC86_RS19615 430905..431009 + 105 WP_099607150.1 acetyltransferase Antitoxin
ALC86_RS16565 431040..431309 + 270 WP_001114075.1 DUF4160 domain-containing protein Toxin
ALC86_RS16570 431303..431824 + 522 WP_000921691.1 DUF2442 domain-containing protein -
ALC86_RS16580 432123..432248 + 126 WP_001905700.1 DUF645 family protein -
ALC86_RS16590 432499..432894 + 396 WP_001000867.1 hypothetical protein -
ALC86_RS16595 433033..433311 - 279 WP_000578476.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
ALC86_RS16600 433308..433592 - 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
ALC86_RS16605 433786..434301 + 516 WP_000343779.1 GNAT family N-acetyltransferase -
ALC86_RS16610 434485..434898 + 414 WP_000049420.1 VOC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639
flank IS/Tn - - 428333..428770 437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF4160

(9-74)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10310.94 Da        Isoelectric Point: 6.6303

>T293836 WP_001114075.1 NZ_LT907990:431040-431309 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC

Download         Length: 270 bp

Antitoxin


Download         Length: 35 a.a.        Molecular weight: 3991.79 Da        Isoelectric Point: 9.2853

>AT293836 WP_099607150.1 NZ_LT907990:430905-431009 [Vibrio cholerae]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL

Download         Length: 105 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A086SLD6

Antitoxin

Source ID Structure

References