Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc(toxin) |
Location | 382743..383314 | Replicon | chromosome |
Accession | NZ_CP090379 | ||
Organism | Vibrio cholerae strain BY369 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q9KMA2 |
Locus tag | LVJ30_RS15860 | Protein ID | WP_000351248.1 |
Coordinates | 382913..383314 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | Q8GNG3 |
Locus tag | LVJ30_RS15855 | Protein ID | WP_001080654.1 |
Coordinates | 382743..382913 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LVJ30_RS15800 (LVJ30_15800) | 377938..378052 | + | 115 | Protein_393 | acetyltransferase | - |
LVJ30_RS15805 (LVJ30_15805) | 378061..378282 | + | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
LVJ30_RS15810 (LVJ30_15810) | 378448..378561 | + | 114 | WP_001889158.1 | hypothetical protein | - |
LVJ30_RS15815 (LVJ30_15815) | 378510..378737 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
LVJ30_RS15820 (LVJ30_15820) | 379078..379410 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
LVJ30_RS15825 (LVJ30_15825) | 379397..379711 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
LVJ30_RS15830 (LVJ30_15830) | 379848..380282 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
LVJ30_RS15835 (LVJ30_15835) | 380450..380605 | + | 156 | WP_000751734.1 | hypothetical protein | - |
LVJ30_RS15840 (LVJ30_15840) | 380730..381710 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
LVJ30_RS15845 (LVJ30_15845) | 381778..382084 | + | 307 | Protein_402 | CatB-related O-acetyltransferase | - |
LVJ30_RS15850 (LVJ30_15850) | 382221..382619 | + | 399 | Protein_403 | GNAT family N-acetyltransferase | - |
LVJ30_RS15855 (LVJ30_15855) | 382743..382913 | + | 171 | WP_001080654.1 | hypothetical protein | Antitoxin |
LVJ30_RS15860 (LVJ30_15860) | 382913..383314 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
LVJ30_RS15865 (LVJ30_15865) | 383317..383427 | + | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
LVJ30_RS15870 (LVJ30_15870) | 383502..383915 | + | 414 | WP_000049417.1 | VOC family protein | - |
LVJ30_RS15875 (LVJ30_15875) | 384129..384380 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
LVJ30_RS15880 (LVJ30_15880) | 384370..384657 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
LVJ30_RS15885 (LVJ30_15885) | 384785..385240 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
LVJ30_RS15890 (LVJ30_15890) | 385297..385419 | + | 123 | Protein_411 | acetyltransferase | - |
LVJ30_RS15895 (LVJ30_15895) | 385590..385714 | + | 125 | Protein_412 | DUF645 family protein | - |
LVJ30_RS15900 (LVJ30_15900) | 385831..385899 | + | 69 | Protein_413 | acetyltransferase | - |
LVJ30_RS15905 (LVJ30_15905) | 385916..386413 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
LVJ30_RS15910 (LVJ30_15910) | 386410..386682 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
LVJ30_RS15915 (LVJ30_15915) | 386834..386896 | + | 63 | Protein_416 | acetyltransferase | - |
LVJ30_RS15920 (LVJ30_15920) | 386913..387581 | + | 669 | WP_000043871.1 | hypothetical protein | - |
LVJ30_RS15925 (LVJ30_15925) | 387733..388020 | + | 288 | WP_000426470.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304645..399892 | 95247 | |
inside | Integron | - | - | 309725..399516 | 89791 | ||
flank | IS/Tn | - | - | 380730..381710 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T230524 WP_000351248.1 NZ_CP090379:382913-383314 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
>T230524 NZ_CP124917:59411-59521 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
Antitoxin
Download Length: 57 a.a. Molecular weight: 6287.35 Da Isoelectric Point: 10.7274
>AT230524 WP_001080654.1 NZ_CP090379:382743-382913 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
Download Length: 171 bp
>AT230524 NZ_CP124917:c59625-59561 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0PN34 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SJJ1 |