230524

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc(toxin)
Location 382743..383314 Replicon chromosome
Accession NZ_CP090379
Organism Vibrio cholerae strain BY369

Toxin (Protein)


Gene name doc Uniprot ID Q9KMA2
Locus tag LVJ30_RS15860 Protein ID WP_000351248.1
Coordinates 382913..383314 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID Q8GNG3
Locus tag LVJ30_RS15855 Protein ID WP_001080654.1
Coordinates 382743..382913 (+) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LVJ30_RS15800 (LVJ30_15800) 377938..378052 + 115 Protein_393 acetyltransferase -
LVJ30_RS15805 (LVJ30_15805) 378061..378282 + 222 WP_032468461.1 DUF1289 domain-containing protein -
LVJ30_RS15810 (LVJ30_15810) 378448..378561 + 114 WP_001889158.1 hypothetical protein -
LVJ30_RS15815 (LVJ30_15815) 378510..378737 + 228 WP_001894457.1 DUF1289 domain-containing protein -
LVJ30_RS15820 (LVJ30_15820) 379078..379410 + 333 WP_000843587.1 type II toxin-antitoxin system RelE/ParE family toxin -
LVJ30_RS15825 (LVJ30_15825) 379397..379711 + 315 WP_000071008.1 DNA-binding transcriptional regulator -
LVJ30_RS15830 (LVJ30_15830) 379848..380282 + 435 WP_000256036.1 GNAT family N-acetyltransferase -
LVJ30_RS15835 (LVJ30_15835) 380450..380605 + 156 WP_000751734.1 hypothetical protein -
LVJ30_RS15840 (LVJ30_15840) 380730..381710 - 981 WP_000019370.1 IS5-like element ISVch5 family transposase -
LVJ30_RS15845 (LVJ30_15845) 381778..382084 + 307 Protein_402 CatB-related O-acetyltransferase -
LVJ30_RS15850 (LVJ30_15850) 382221..382619 + 399 Protein_403 GNAT family N-acetyltransferase -
LVJ30_RS15855 (LVJ30_15855) 382743..382913 + 171 WP_001080654.1 hypothetical protein Antitoxin
LVJ30_RS15860 (LVJ30_15860) 382913..383314 + 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
LVJ30_RS15865 (LVJ30_15865) 383317..383427 + 111 WP_082798255.1 DUF3265 domain-containing protein -
LVJ30_RS15870 (LVJ30_15870) 383502..383915 + 414 WP_000049417.1 VOC family protein -
LVJ30_RS15875 (LVJ30_15875) 384129..384380 + 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
LVJ30_RS15880 (LVJ30_15880) 384370..384657 + 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin -
LVJ30_RS15885 (LVJ30_15885) 384785..385240 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
LVJ30_RS15890 (LVJ30_15890) 385297..385419 + 123 Protein_411 acetyltransferase -
LVJ30_RS15895 (LVJ30_15895) 385590..385714 + 125 Protein_412 DUF645 family protein -
LVJ30_RS15900 (LVJ30_15900) 385831..385899 + 69 Protein_413 acetyltransferase -
LVJ30_RS15905 (LVJ30_15905) 385916..386413 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
LVJ30_RS15910 (LVJ30_15910) 386410..386682 - 273 WP_000246253.1 DUF1778 domain-containing protein -
LVJ30_RS15915 (LVJ30_15915) 386834..386896 + 63 Protein_416 acetyltransferase -
LVJ30_RS15920 (LVJ30_15920) 386913..387581 + 669 WP_000043871.1 hypothetical protein -
LVJ30_RS15925 (LVJ30_15925) 387733..388020 + 288 WP_000426470.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304645..399892 95247
inside Integron - - 309725..399516 89791
flank IS/Tn - - 380730..381710 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-132)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14608.71 Da        Isoelectric Point: 4.0128

>T230524 WP_000351248.1 NZ_CP090379:382913-383314 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL

Download         Length: 402 bp

>T230524 NZ_CP124917:59411-59521 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6287.35 Da        Isoelectric Point: 10.7274

>AT230524 WP_001080654.1 NZ_CP090379:382743-382913 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM

Download         Length: 171 bp

>AT230524 NZ_CP124917:c59625-59561 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0PN34

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SJJ1

References