Detailed information of TA system TA230524

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): phd-doc/Doc(toxin)
• Location: 382743..383314
• Replicon: chromosome
• Accession: NZ_CP090379
• Organism: Vibrio cholerae strain BY369

Toxin (Protein)

• Gene name: doc
• Uniprot ID: Q9KMA2
• Locus tag: LVJ30_RS15860
• Protein ID: WP_000351248.1
• Coordinates: 382913..383314 (+)
• Length: 134 a.a.

Antitoxin (Protein)

• Gene name: phd
• Uniprot ID: Q8GNG3
• Locus tag: LVJ30_RS15855
• Protein ID: WP_001080654.1
• Coordinates: 382743..382913 (+)
• Length: 57 a.a.

Genomic Context

Location: 377938..378052 (115 bp)
Type: Others
Protein ID: Protein_393

Location: 378061..378282 (222 bp)
Type: Others
Protein ID: WP_032468461.1

Location: 378448..378561 (114 bp)
Type: Others
Protein ID: WP_001889158.1

Location: 378510..378737 (228 bp)
Type: Others
Protein ID: WP_001894457.1

Location: 379078..379410 (333 bp)
Type: Others
Protein ID: WP_000843587.1

Location: 379397..379711 (315 bp)
Type: Others
Protein ID: WP_000071008.1

Location: 379848..380282 (435 bp)
Type: Others
Protein ID: WP_000256036.1

Location: 380450..380605 (156 bp)
Type: Others
Protein ID: WP_000751734.1

Location: 381778..382084 (307 bp)
Type: Others
Protein ID: Protein_402

Location: 382221..382619 (399 bp)
Type: Others
Protein ID: Protein_403

Location: 382743..382913 (171 bp)
Type: Antitoxin
Protein ID: WP_001080654.1

Location: 382913..383314 (402 bp)
Type: Toxin
Protein ID: WP_000351248.1

Location: 383317..383427 (111 bp)
Type: Others
Protein ID: WP_082798255.1

Location: 383502..383915 (414 bp)
Type: Others
Protein ID: WP_000049417.1

Location: 384129..384380 (252 bp)
Type: Others
Protein ID: WP_001250179.1

Location: 384370..384657 (288 bp)
Type: Others
Protein ID: WP_000221354.1

Location: 384785..385240 (456 bp)
Type: Others
Protein ID: WP_001245327.1

Location: 385297..385419 (123 bp)
Type: Others
Protein ID: Protein_411

Location: 385590..385714 (125 bp)
Type: Others
Protein ID: Protein_412

Location: 385831..385899 (69 bp)
Type: Others
Protein ID: Protein_413

Location: 386834..386896 (63 bp)
Type: Others
Protein ID: Protein_416

Location: 386913..387581 (669 bp)
Type: Others
Protein ID: WP_000043871.1

Location: 387733..388020 (288 bp)
Type: Others
Protein ID: WP_000426470.1

Location: 380730..381710 (981 bp)
Type: Others
Protein ID: WP_000019370.1

Location: 385916..386413 (498 bp)
Type: Others
Protein ID: WP_000982260.1

Location: 386410..386682 (273 bp)
Type: Others
Protein ID: WP_000246253.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LVJ30_RS15800 (LVJ30_15800)	377938..378052	+	115	Protein_393	acetyltransferase	-
LVJ30_RS15805 (LVJ30_15805)	378061..378282	+	222	WP_032468461.1	DUF1289 domain-containing protein	-
LVJ30_RS15810 (LVJ30_15810)	378448..378561	+	114	WP_001889158.1	hypothetical protein	-
LVJ30_RS15815 (LVJ30_15815)	378510..378737	+	228	WP_001894457.1	DUF1289 domain-containing protein	-
LVJ30_RS15820 (LVJ30_15820)	379078..379410	+	333	WP_000843587.1	type II toxin-antitoxin system RelE/ParE family toxin	-
LVJ30_RS15825 (LVJ30_15825)	379397..379711	+	315	WP_000071008.1	DNA-binding transcriptional regulator	-
LVJ30_RS15830 (LVJ30_15830)	379848..380282	+	435	WP_000256036.1	GNAT family N-acetyltransferase	-
LVJ30_RS15835 (LVJ30_15835)	380450..380605	+	156	WP_000751734.1	hypothetical protein	-
LVJ30_RS15840 (LVJ30_15840)	380730..381710	-	981	WP_000019370.1	IS5-like element ISVch5 family transposase	-
LVJ30_RS15845 (LVJ30_15845)	381778..382084	+	307	Protein_402	CatB-related O-acetyltransferase	-
LVJ30_RS15850 (LVJ30_15850)	382221..382619	+	399	Protein_403	GNAT family N-acetyltransferase	-
LVJ30_RS15855 (LVJ30_15855)	382743..382913	+	171	WP_001080654.1	hypothetical protein	Antitoxin
LVJ30_RS15860 (LVJ30_15860)	382913..383314	+	402	WP_000351248.1	type II toxin-antitoxin system death-on-curing family toxin	Toxin
LVJ30_RS15865 (LVJ30_15865)	383317..383427	+	111	WP_082798255.1	DUF3265 domain-containing protein	-
LVJ30_RS15870 (LVJ30_15870)	383502..383915	+	414	WP_000049417.1	VOC family protein	-
LVJ30_RS15875 (LVJ30_15875)	384129..384380	+	252	WP_001250179.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
LVJ30_RS15880 (LVJ30_15880)	384370..384657	+	288	WP_000221354.1	type II toxin-antitoxin system RelE/ParE family toxin	-
LVJ30_RS15885 (LVJ30_15885)	384785..385240	+	456	WP_001245327.1	GNAT family N-acetyltransferase	-
LVJ30_RS15890 (LVJ30_15890)	385297..385419	+	123	Protein_411	acetyltransferase	-
LVJ30_RS15895 (LVJ30_15895)	385590..385714	+	125	Protein_412	DUF645 family protein	-
LVJ30_RS15900 (LVJ30_15900)	385831..385899	+	69	Protein_413	acetyltransferase	-
LVJ30_RS15905 (LVJ30_15905)	385916..386413	-	498	WP_000982260.1	GNAT family N-acetyltransferase	-
LVJ30_RS15910 (LVJ30_15910)	386410..386682	-	273	WP_000246253.1	DUF1778 domain-containing protein	-
LVJ30_RS15915 (LVJ30_15915)	386834..386896	+	63	Protein_416	acetyltransferase	-
LVJ30_RS15920 (LVJ30_15920)	386913..387581	+	669	WP_000043871.1	hypothetical protein	-
LVJ30_RS15925 (LVJ30_15925)	387733..388020	+	288	WP_000426470.1	hypothetical protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	catB9	-	304645..399892	95247
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA000164, TA000169, TA000166, TA000167, TA000179, TA000170, TA000171, TA000172, TA000173, TA000174, TA000175, TA000176, TA000177, TA000178, TA000168, TA000165, TA010030, TA010035 309750..435387 0.005	inside	Integron	-	-	309725..399516	89791
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 IS/Tn TA000174, TA000175, TA000176, TA010030 416601..417581 0	flank	IS/Tn	-	-	380730..381710	980

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Death on curing protein (1-132)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 134 a.a.
• Molecular weight: 14608.71 Da
• Isoelectric Point: 4.0128

>T230524 WP_000351248.1 NZ_CP090379:382913-383314 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL

Nucleotide

• Length: 402 bp

>T230524 NZ_CP124917:59411-59521 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA

Antitoxin

Protein

• Length: 57 a.a.
• Molecular weight: 6287.35 Da
• Isoelectric Point: 10.7274

>AT230524 WP_001080654.1 NZ_CP090379:382743-382913 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM

Nucleotide

• Length: 171 bp

>AT230524 NZ_CP124917:c59625-59561 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A0Q0PN34

Antitoxin

Loading, please wait

• AlphaFold DB: A0A1T4SJJ1