294373

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 392535..393301 Replicon chromosome
Accession NZ_LT992489
Organism Vibrio cholerae strain 4295STDY6534232

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag DG176_RS16155 Protein ID WP_000982260.1
Coordinates 392804..393301 (+) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag DG176_RS16150 Protein ID WP_000246253.1
Coordinates 392535..392807 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG176_RS16105 387763..388680 - 918 WP_000186333.1 alpha/beta hydrolase -
DG176_RS16110 388914..389216 - 303 WP_000229317.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG176_RS16115 389204..389461 - 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG176_RS16125 389663..390196 - 534 WP_000118351.1 GNAT family N-acetyltransferase -
DG176_RS16130 390193..390618 - 426 WP_001882332.1 DUF1778 domain-containing protein -
DG176_RS16135 390685..391056 - 372 WP_001164080.1 nucleotide pyrophosphohydrolase -
DG176_RS16140 391197..391484 - 288 WP_000426470.1 hypothetical protein -
DG176_RS16145 391636..392304 - 669 WP_000043871.1 hypothetical protein -
DG176_RS16150 392535..392807 + 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
DG176_RS16155 392804..393301 + 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
DG176_RS16165 393503..393655 - 153 WP_001884520.1 DUF645 family protein -
DG176_RS16170 393977..394432 - 456 WP_001245327.1 GNAT family N-acetyltransferase -
DG176_RS16175 394560..394847 - 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG176_RS16180 394837..395088 - 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG176_RS16185 395302..395715 - 414 WP_000049417.1 VOC family protein -
DG176_RS16190 395790..395933 - 144 WP_071908341.1 DUF3265 domain-containing protein -
DG176_RS16195 395903..396304 - 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin -
DG176_RS16200 396304..396996 - 693 WP_001047169.1 GNAT family N-acetyltransferase -
DG176_RS16205 397133..397439 - 307 Protein_349 CatB-related O-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 379325..476297 96972
flank IS/Tn - - 397507..398487 980
inside Integron catB9 - 379701..469509 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T294373 WP_000982260.1 NZ_LT992489:392804-393301 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT294373 WP_000246253.1 NZ_LT992489:392535-392807 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References