Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 401002..401549 | Replicon | chromosome |
Accession | NZ_CP006948 | ||
Organism | Vibrio cholerae O1 str. KW3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q9KM92 |
Locus tag | N900_RS16085 | Protein ID | WP_000229317.1 |
Coordinates | 401247..401549 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | N900_RS16080 | Protein ID | WP_000861987.1 |
Coordinates | 401002..401259 (+) | Length | 86 a.a. |
Genomic Context
Location: 396031..396486 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 396808..396960 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 398159..398827 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 398979..399266 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 399407..399778 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 399845..400270 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 400267..400800 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 401002..401259 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 401247..401549 (303 bp)
Type: Toxin
Protein ID: WP_000229317.1
Type: Toxin
Protein ID: WP_000229317.1
Location: 401783..402699 (917 bp)
Type: Others
Protein ID: Protein_421
Type: Others
Protein ID: Protein_421
Location: 402856..403245 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 403381..403590 (210 bp)
Type: Others
Protein ID: Protein_423
Type: Others
Protein ID: Protein_423
Location: 403709..404146 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 404210..404428 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 404603..405475 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 405625..406224 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 406281..406385 (105 bp)
Type: Others
Protein ID: WP_099607150.1
Type: Others
Protein ID: WP_099607150.1
Location: 397162..397659 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 397656..397928 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N900_RS16035 | 396031..396486 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
N900_RS16040 | 396808..396960 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
N900_RS16045 | 397162..397659 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
N900_RS16050 | 397656..397928 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
N900_RS16055 | 398159..398827 | + | 669 | WP_000043871.1 | hypothetical protein | - |
N900_RS16060 | 398979..399266 | + | 288 | WP_000426470.1 | hypothetical protein | - |
N900_RS16065 | 399407..399778 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
N900_RS16070 | 399845..400270 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
N900_RS16075 | 400267..400800 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
N900_RS16080 | 401002..401259 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N900_RS16085 | 401247..401549 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N900_RS16090 | 401783..402699 | + | 917 | Protein_421 | alpha/beta hydrolase | - |
N900_RS16095 | 402856..403245 | + | 390 | WP_001081302.1 | hypothetical protein | - |
N900_RS16100 | 403381..403590 | + | 210 | Protein_423 | GNAT family N-acetyltransferase | - |
N900_RS16105 | 403709..404146 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
N900_RS16110 | 404210..404428 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
N900_RS16115 | 404603..405475 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
N900_RS16120 | 405625..406224 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
N900_RS20070 | 406281..406385 | + | 105 | WP_099607150.1 | acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304645..411088 | 106443 | |
inside | Integron | - | - | 309725..410760 | 101035 | ||
flank | IS/Tn | - | - | 403709..404146 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T45816 WP_000229317.1 NZ_CP006948:401247-401549 [Vibrio cholerae O1 str. KW3]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T45816 NZ_CP006948:401247-401549 [Vibrio cholerae O1 str. KW3]
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
ATGGTTGAAATAATTTGGACGGAGCTGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
Antitoxin
Download Length: 86 a.a. Molecular weight: 9647.15 Da Isoelectric Point: 7.3178
>AT45816 WP_000861987.1 NZ_CP006948:401002-401259 [Vibrio cholerae O1 str. KW3]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
Download Length: 258 bp
>AT45816 NZ_CP006948:401002-401259 [Vibrio cholerae O1 str. KW3]
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM92 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |