294361

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 964384..964882 Replicon chromosome
Accession NZ_LT992487
Organism Vibrio cholerae strain 4295STDY6534216

Toxin (Protein)


Gene name - Uniprot ID Q9KMK7
Locus tag DG247_RS19020 Protein ID WP_000589156.1
Coordinates 964616..964882 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9KMK6
Locus tag DG247_RS19015 Protein ID WP_000643598.1
Coordinates 964384..964629 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG247_RS18955 959874..960053 - 180 WP_001883058.1 DUF645 family protein -
DG247_RS18970 960631..960741 - 111 WP_079857360.1 DUF3265 domain-containing protein -
DG247_RS18975 960751..961449 - 699 WP_001890502.1 hypothetical protein -
DG247_RS18980 961572..962198 - 627 WP_000365424.1 LysE family translocator -
DG247_RS18985 962240..962332 - 93 WP_014378730.1 DUF3265 domain-containing protein -
DG247_RS18990 962347..962820 - 474 WP_001161076.1 GrpB family protein -
DG247_RS18995 963020..963202 - 183 WP_000923182.1 DUF645 family protein -
DG247_RS19840 963263..963391 - 129 WP_071908338.1 general secretion pathway protein GspI -
DG247_RS19010 963494..964288 - 795 WP_001911581.1 hypothetical protein -
DG247_RS19015 964384..964629 - 246 WP_000643598.1 hypothetical protein Antitoxin
DG247_RS19020 964616..964882 - 267 WP_000589156.1 BrnT family toxin Toxin
DG247_RS19030 965067..965729 - 663 WP_000960654.1 hypothetical protein -
DG247_RS19035 965857..966324 - 468 WP_001289288.1 OsmC family protein -
DG247_RS19845 966536..966574 - 39 WP_082798268.1 hypothetical protein -
DG247_RS19850 966628..966771 - 144 Protein_877 DUF645 family protein -
DG247_RS19055 967146..967424 - 279 WP_000280324.1 DUF3709 domain-containing protein -
DG247_RS19060 967676..967918 - 243 WP_000107461.1 hypothetical protein -
DG247_RS19065 968010..968159 - 150 WP_071908333.1 DUF3265 domain-containing protein -
DG247_RS19070 968132..968383 - 252 WP_001890111.1 TIGR03643 family protein -
DG247_RS19075 968578..968964 - 387 WP_000703163.1 VOC family protein -
DG247_RS19080 968954..969055 - 102 WP_001921603.1 hypothetical protein -
DG247_RS19085 969255..969461 - 207 Protein_884 DUF3709 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 897525..994497 96972
inside Integron catB9 - 897901..987709 89808


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10092.34 Da        Isoelectric Point: 7.3171

>T294361 WP_000589156.1 NZ_LT992487:c964882-964616 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA

Download         Length: 267 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9478.77 Da        Isoelectric Point: 6.4832

>AT294361 WP_000643598.1 NZ_LT992487:c964629-964384 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A271VMP7

Antitoxin

Source ID Structure
AlphaFold DB A0A271VME2

References