Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
Location | 424468..425423 | Replicon | chromosome |
Accession | NZ_LT906615 | ||
Organism | Vibrio cholerae O1 biovar El Tor str. N16961 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KM94 |
Locus tag | FY484_RS16470 | Protein ID | WP_000118351.1 |
Coordinates | 424890..425423 (+) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | FY484_RS19570 | Protein ID | WP_001882332.1 |
Coordinates | 424468..424893 (+) | Length | 142 a.a. |
Genomic Context
Location: 419998..420249 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 420239..420526 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 420654..421109 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 421431..421583 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 422782..423450 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 423602..423889 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 424030..424401 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 424468..424893 (426 bp)
Type: Antitoxin
Protein ID: WP_001882332.1
Type: Antitoxin
Protein ID: WP_001882332.1
Location: 424890..425423 (534 bp)
Type: Toxin
Protein ID: WP_000118351.1
Type: Toxin
Protein ID: WP_000118351.1
Location: 425625..425882 (258 bp)
Type: Others
Protein ID: WP_000861987.1
Type: Others
Protein ID: WP_000861987.1
Location: 425870..426172 (303 bp)
Type: Others
Protein ID: WP_000229317.1
Type: Others
Protein ID: WP_000229317.1
Location: 426406..427323 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 427480..427869 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 428005..428214 (210 bp)
Type: Others
Protein ID: Protein_466
Type: Others
Protein ID: Protein_466
Location: 428333..428770 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 428834..429052 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 429227..430099 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 421785..422282 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 422279..422551 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FY484_RS16415 | 419998..420249 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
FY484_RS16420 | 420239..420526 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
FY484_RS16425 | 420654..421109 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
FY484_RS16430 | 421431..421583 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
FY484_RS16440 | 421785..422282 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
FY484_RS16445 | 422279..422551 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
FY484_RS16450 | 422782..423450 | + | 669 | WP_000043871.1 | hypothetical protein | - |
FY484_RS16455 | 423602..423889 | + | 288 | WP_000426470.1 | hypothetical protein | - |
FY484_RS16460 | 424030..424401 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
FY484_RS19570 | 424468..424893 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | Antitoxin |
FY484_RS16470 | 424890..425423 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | Toxin |
FY484_RS16480 | 425625..425882 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
FY484_RS16485 | 425870..426172 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
FY484_RS16490 | 426406..427323 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
FY484_RS16495 | 427480..427869 | + | 390 | WP_001081302.1 | hypothetical protein | - |
FY484_RS16500 | 428005..428214 | + | 210 | Protein_466 | GNAT family N-acetyltransferase | - |
FY484_RS16505 | 428333..428770 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
FY484_RS16510 | 428834..429052 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
FY484_RS16515 | 429227..430099 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
inside | Integron | catB9 | - | 309746..435385 | 125639 | ||
flank | IS/Tn | - | - | 428333..428770 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 20171.46 Da Isoelectric Point: 9.1432
>T293805 WP_000118351.1 NZ_LT906615:424890-425423 [Vibrio cholerae O1 biovar El Tor str. N16961]
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAHPLLNQKFAICAFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMFLPMKTVEQLFNQ
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAHPLLNQKFAICAFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMFLPMKTVEQLFNQ
Download Length: 534 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15714.41 Da Isoelectric Point: 7.6659
>AT293805 WP_001882332.1 NZ_LT906615:424468-424893 [Vibrio cholerae O1 biovar El Tor str. N16961]
MLCLSLVVMRCQPLRRALYSPSPRKLSVRIECALSLAYNRSTDGMYPYAGGVMATARLDIRLDEEIKAKAEKASALLGLK
SLTEYVVRLMDEDATHVIEEHESIMVKDSVFDEFMAACNKVKAPNQALLEAVKFTEKSGIK
MLCLSLVVMRCQPLRRALYSPSPRKLSVRIECALSLAYNRSTDGMYPYAGGVMATARLDIRLDEEIKAKAEKASALLGLK
SLTEYVVRLMDEDATHVIEEHESIMVKDSVFDEFMAACNKVKAPNQALLEAVKFTEKSGIK
Download Length: 426 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9KM94 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |