Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 382751..383366 | Replicon | chromosome |
Accession | NZ_CP013318 | ||
Organism | Vibrio cholerae strain NCTC5395 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMG5 |
Locus tag | ASZ85_RS16065 | Protein ID | WP_001162670.1 |
Coordinates | 382751..383038 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ASZ85_RS16070 | Protein ID | WP_001232701.1 |
Coordinates | 383049..383366 (+) | Length | 106 a.a. |
Genomic Context
Location: 378243..378500 (258 bp)
Type: Others
Protein ID: WP_000861987.1
Type: Others
Protein ID: WP_000861987.1
Location: 378488..378790 (303 bp)
Type: Others
Protein ID: WP_000229318.1
Type: Others
Protein ID: WP_000229318.1
Location: 379079..379303 (225 bp)
Type: Others
Protein ID: WP_001894423.1
Type: Others
Protein ID: WP_001894423.1
Location: 379747..379866 (120 bp)
Type: Others
Protein ID: WP_071919600.1
Type: Others
Protein ID: WP_071919600.1
Location: 379870..379923 (54 bp)
Type: Others
Protein ID: Protein_360
Type: Others
Protein ID: Protein_360
Location: 380525..381529 (1005 bp)
Type: Others
Protein ID: WP_000964931.1
Type: Others
Protein ID: WP_000964931.1
Location: 382304..382484 (181 bp)
Type: Others
Protein ID: Protein_362
Type: Others
Protein ID: Protein_362
Location: 382751..383038 (288 bp)
Type: Toxin
Protein ID: WP_001162670.1
Type: Toxin
Protein ID: WP_001162670.1
Location: 383049..383366 (318 bp)
Type: Antitoxin
Protein ID: WP_001232701.1
Type: Antitoxin
Protein ID: WP_001232701.1
Location: 383363..383473 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 383519..384058 (540 bp)
Type: Others
Protein ID: WP_000099372.1
Type: Others
Protein ID: WP_000099372.1
Location: 384203..384637 (435 bp)
Type: Others
Protein ID: WP_000453680.1
Type: Others
Protein ID: WP_000453680.1
Location: 384864..385142 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 385394..385600 (207 bp)
Type: Others
Protein ID: Protein_369
Type: Others
Protein ID: Protein_369
Location: 385800..385901 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 385891..386277 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 386472..386723 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 386696..386845 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 387058..387210 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 387411..387782 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 388078..388260 (183 bp)
Type: Others
Protein ID: WP_001900194.1
Type: Others
Protein ID: WP_001900194.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ85_RS16020 | 378243..378500 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ASZ85_RS16025 | 378488..378790 | + | 303 | WP_000229318.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ASZ85_RS16030 | 379079..379303 | + | 225 | WP_001894423.1 | DUF3709 domain-containing protein | - |
ASZ85_RS16035 | 379747..379866 | + | 120 | WP_071919600.1 | DUF645 family protein | - |
ASZ85_RS21000 | 379870..379923 | + | 54 | Protein_360 | DUF645 family protein | - |
ASZ85_RS16050 | 380525..381529 | + | 1005 | WP_000964931.1 | LD-carboxypeptidase | - |
ASZ85_RS16060 | 382304..382484 | + | 181 | Protein_362 | DUF645 family protein | - |
ASZ85_RS16065 | 382751..383038 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ85_RS16070 | 383049..383366 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | Antitoxin |
ASZ85_RS21445 | 383363..383473 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
ASZ85_RS16080 | 383519..384058 | + | 540 | WP_000099372.1 | hypothetical protein | - |
ASZ85_RS16085 | 384203..384637 | + | 435 | WP_000453680.1 | GNAT family N-acetyltransferase | - |
ASZ85_RS16090 | 384864..385142 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
ASZ85_RS21020 | 385394..385600 | + | 207 | Protein_369 | DUF3709 domain-containing protein | - |
ASZ85_RS21025 | 385800..385901 | + | 102 | WP_001921603.1 | hypothetical protein | - |
ASZ85_RS16095 | 385891..386277 | + | 387 | WP_000703163.1 | VOC family protein | - |
ASZ85_RS16100 | 386472..386723 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
ASZ85_RS16105 | 386696..386845 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
ASZ85_RS16110 | 387058..387210 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
ASZ85_RS16115 | 387411..387782 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
ASZ85_RS16120 | 388078..388260 | + | 183 | WP_001900194.1 | DUF645 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 338285..496833 | 158548 | |
inside | Integron | - | - | 343365..496457 | 153092 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11349.95 Da Isoelectric Point: 6.7187
>T58397 WP_001162670.1 NZ_CP013318:382751-383038 [Vibrio cholerae]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
Download Length: 288 bp
>T58397 NZ_CP013318:382751-383038 [Vibrio cholerae]
ATGGCATTAGAATTTAAAGATAAGTGGTTAGAGCAGTTTTACGAGGATGATAAACGACATCGTTTAATTCCAAGTAGCAT
AGAGAATGCTCTATTTCGGAAGCTGGAAATCTTAGATGCAGCTCAAGCTGAATCAGACTTAAGAATTCCACCGGGTAATC
GTTTTGAACATCTTGAAGGAAATCTTAAAGGTTGGTGTTCAATTCGAGTGAACAAACAGTATCGTTTGATTTTTCAGTGG
GTTGATGGTGTTGCACTAAATACTTACTTAGACCCACATAAGTATTGA
ATGGCATTAGAATTTAAAGATAAGTGGTTAGAGCAGTTTTACGAGGATGATAAACGACATCGTTTAATTCCAAGTAGCAT
AGAGAATGCTCTATTTCGGAAGCTGGAAATCTTAGATGCAGCTCAAGCTGAATCAGACTTAAGAATTCCACCGGGTAATC
GTTTTGAACATCTTGAAGGAAATCTTAAAGGTTGGTGTTCAATTCGAGTGAACAAACAGTATCGTTTGATTTTTCAGTGG
GTTGATGGTGTTGCACTAAATACTTACTTAGACCCACATAAGTATTGA
Antitoxin
Download Length: 106 a.a. Molecular weight: 11705.63 Da Isoelectric Point: 10.4711
>AT58397 WP_001232701.1 NZ_CP013318:383049-383366 [Vibrio cholerae]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
Download Length: 318 bp
>AT58397 NZ_CP013318:383049-383366 [Vibrio cholerae]
ATGCGTAAGACAAAACGTCGTCCAGTTAGCGTTGGGGAAATGTTAAAAGTTGAATTTCTTGAACCAATGGGCATCACATC
AAAAGCGCTCGCTGAAGCGATGGGCGTACACAGAAATACGGTCAGTAATTTAATTAATGGTGGTGTGTTAACAGCTCCGG
TAGCAATCAAGTTAGCCGCGGCATTAGGTAACACACCAGAATTTTGGCTTAACATTCAACATGCAGTTGATCTTTGGGAT
ACGAGAAATCGTTATCAAGAAGAAGCAAAGTTTGTAAAGCCGTTGTTTGTTTCGCTGGAACAAAGCGCACGTACATAA
ATGCGTAAGACAAAACGTCGTCCAGTTAGCGTTGGGGAAATGTTAAAAGTTGAATTTCTTGAACCAATGGGCATCACATC
AAAAGCGCTCGCTGAAGCGATGGGCGTACACAGAAATACGGTCAGTAATTTAATTAATGGTGGTGTGTTAACAGCTCCGG
TAGCAATCAAGTTAGCCGCGGCATTAGGTAACACACCAGAATTTTGGCTTAACATTCAACATGCAGTTGATCTTTGGGAT
ACGAGAAATCGTTATCAAGAAGAAGCAAAGTTTGTAAAGCCGTTGTTTGTTTCGCTGGAACAAAGCGCACGTACATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F2HI36 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |