Detailed information of TA system TA293838

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/RelE-RelB
• Location: 433033..433592
• Replicon: chromosome
• Accession: NZ_LT907990
• Organism: Vibrio cholerae strain A19

Toxin (Protein)

• Gene name: relE
• Uniprot ID: Q9K2M8
• Locus tag: ALC86_RS16595
• Protein ID: WP_000578476.1
• Coordinates: 433033..433311 (-)
• Length: 93 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: Q9L991
• Locus tag: ALC86_RS16600
• Protein ID: WP_000381183.1
• Coordinates: 433308..433592 (-)
• Length: 95 a.a.

Genomic Context

Location: 428333..428770 (438 bp)
Type: Others
Protein ID: WP_000503169.1

Location: 428834..429052 (219 bp)
Type: Others
Protein ID: WP_071908318.1

Location: 429227..430099 (873 bp)
Type: Others
Protein ID: WP_000254716.1

Location: 430249..430848 (600 bp)
Type: Others
Protein ID: WP_001891245.1

Location: 430905..431009 (105 bp)
Type: Others
Protein ID: WP_099607150.1

Location: 431040..431309 (270 bp)
Type: Others
Protein ID: WP_001114075.1

Location: 431303..431824 (522 bp)
Type: Others
Protein ID: WP_000921691.1

Location: 432123..432248 (126 bp)
Type: Others
Protein ID: WP_001905700.1

Location: 432499..432894 (396 bp)
Type: Others
Protein ID: WP_001000867.1

Location: 433786..434301 (516 bp)
Type: Others
Protein ID: WP_000343779.1

Location: 434485..434898 (414 bp)
Type: Others
Protein ID: WP_000049420.1

Location: 435453..436630 (1178 bp)
Type: Others
Protein ID: WP_086010879.1

Location: 433033..433311 (279 bp)
Type: Toxin
Protein ID: WP_000578476.1

Location: 433308..433592 (285 bp)
Type: Antitoxin
Protein ID: WP_000381183.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ALC86_RS16545	428333..428770	+	438	WP_000503169.1	IS200/IS605-like element IS1004 family transposase	-
ALC86_RS16550	428834..429052	+	219	WP_071908318.1	GNAT family N-acetyltransferase	-
ALC86_RS16555	429227..430099	+	873	WP_000254716.1	DUF3800 domain-containing protein	-
ALC86_RS16560	430249..430848	+	600	WP_001891245.1	glutathione S-transferase N-terminal domain-containing protein	-
ALC86_RS19615	430905..431009	+	105	WP_099607150.1	acetyltransferase	-
ALC86_RS16565	431040..431309	+	270	WP_001114075.1	DUF4160 domain-containing protein	-
ALC86_RS16570	431303..431824	+	522	WP_000921691.1	DUF2442 domain-containing protein	-
ALC86_RS16580	432123..432248	+	126	WP_001905700.1	DUF645 family protein	-
ALC86_RS16590	432499..432894	+	396	WP_001000867.1	hypothetical protein	-
ALC86_RS16595	433033..433311	-	279	WP_000578476.1	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	Toxin
ALC86_RS16600	433308..433592	-	285	WP_000381183.1	type II toxin-antitoxin system RelB/DinJ family antitoxin	Antitoxin
ALC86_RS16605	433786..434301	+	516	WP_000343779.1	GNAT family N-acetyltransferase	-
ALC86_RS16610	434485..434898	+	414	WP_000049420.1	VOC family protein	-
ALC86_RS16620	435453..436630	+	1178	WP_086010879.1	IS3-like element ISVch4 family transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	catB9	-	304666..435761	131095
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 Integron TA000164, TA000169, TA000166, TA000167, TA000179, TA000170, TA000171, TA000172, TA000173, TA000174, TA000175, TA000176, TA000177, TA000178, TA000168, TA000165, TA010030, TA010035 309750..435387 0	inside	Integron	catB9	-	309746..435385	125639
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 IS/Tn TA000179, TA000177, TA000178, TA010035 428335..428772 0	flank	IS/Tn	-	-	428333..428770	437

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (2-89)

Antitoxin

• RelB antitoxin/Antitoxin DinJ (5-70)

Sequences

Toxin

Protein

• Length: 93 a.a.
• Molecular weight: 10819.59 Da
• Isoelectric Point: 5.1651

>T293838 WP_000578476.1 NZ_LT907990:c433311-433033 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Nucleotide

• Length: 279 bp

Antitoxin

Protein

• Length: 95 a.a.
• Molecular weight: 10901.25 Da
• Isoelectric Point: 8.0775

>AT293838 WP_000381183.1 NZ_LT907990:c433592-433308 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Nucleotide

• Length: 285 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: Q9K2M8

Antitoxin

Loading, please wait

• AlphaFold DB: A0A067BL33