145845

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 331544..332084 Replicon chromosome
Accession NZ_CP047300
Organism Vibrio cholerae O1 biovar El Tor strain P27459

Toxin (Protein)


Gene name relE Uniprot ID A0A151JGK8
Locus tag GTF71_RS14920 Protein ID WP_000277238.1
Coordinates 331544..331813 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KML3
Locus tag GTF71_RS14925 Protein ID WP_001258569.1
Coordinates 331806..332084 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GTF71_RS14860 326548..326790 - 243 WP_000557292.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
GTF71_RS14865 327034..327420 + 387 WP_001015867.1 NUDIX hydrolase -
GTF71_RS14870 327477..327590 + 114 WP_001900214.1 hypothetical protein -
GTF71_RS14875 327539..327820 + 282 WP_001894429.1 DUF1289 domain-containing protein -
GTF71_RS14880 327796..327954 - 159 WP_001886450.1 DUF1196 family protein -
GTF71_RS14885 328078..328614 + 537 WP_000469482.1 GNAT family N-acetyltransferase -
GTF71_RS14890 328751..329266 + 516 WP_001201509.1 lipocalin family protein -
GTF71_RS14895 329416..329913 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
GTF71_RS14900 329910..330182 - 273 WP_000246253.1 DUF1778 domain-containing protein -
GTF71_RS14905 330575..330700 + 126 WP_001900195.1 DUF645 family protein -
GTF71_RS14910 330716..330754 + 39 WP_106019118.1 hypothetical protein -
GTF71_RS14915 330950..331396 + 447 WP_000006157.1 hypothetical protein -
GTF71_RS14920 331544..331813 - 270 WP_000277238.1 type II toxin-antitoxin system YafQ family toxin Toxin
GTF71_RS14925 331806..332084 - 279 WP_001258569.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
GTF71_RS14930 332370..332648 + 279 WP_001921601.1 DUF3709 domain-containing protein -
GTF71_RS14935 332900..333106 + 207 Protein_297 DUF3709 domain-containing protein -
GTF71_RS14940 333306..333407 + 102 WP_001921603.1 hypothetical protein -
GTF71_RS14945 333397..333783 + 387 WP_000703163.1 VOC family protein -
GTF71_RS14950 333978..334229 + 252 WP_001890111.1 TIGR03643 family protein -
GTF71_RS14955 334202..334351 + 150 WP_071908333.1 DUF3265 domain-containing protein -
GTF71_RS14960 334443..334685 + 243 WP_000107461.1 hypothetical protein -
GTF71_RS14965 334937..335215 + 279 WP_000280324.1 DUF3709 domain-containing protein -
GTF71_RS14970 335590..335733 + 144 Protein_304 DUF645 family protein -
GTF71_RS14975 335787..335825 + 39 WP_082798268.1 hypothetical protein -
GTF71_RS14980 336037..336504 + 468 WP_001289288.1 OsmC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 306926..439292 132366
inside Integron - - 312006..438916 126910


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-85)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10406.11 Da        Isoelectric Point: 9.5084

>T145845 WP_000277238.1 NZ_CP047300:c331813-331544 [Vibrio cholerae O1 biovar El Tor]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF

Download         Length: 270 bp

>T145845 NZ_CP062702:3044134-3044241 [Escherichia coli O157:H7]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10088.58 Da        Isoelectric Point: 6.0728

>AT145845 WP_001258569.1 NZ_CP047300:c332084-331806 [Vibrio cholerae O1 biovar El Tor]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV

Download         Length: 279 bp

>AT145845 NZ_CP062702:c3044081-3044020 [Escherichia coli O157:H7]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A151JGK8

Antitoxin

Source ID Structure
AlphaFold DB A0A151KTP9

References