Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 388415..388974 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name relE Uniprot ID Q9K2M8
Locus tag OC617_RS15720 Protein ID WP_000578476.1
Coordinates 388415..388693 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9L991
Locus tag OC617_RS15725 Protein ID WP_000381183.1
Coordinates 388690..388974 (-) Length 95 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS15670 (CNRVC190243H_03103) 383493..383999 + 507 WP_000393074.1 hypothetical protein -
OC617_RS15675 (CNRVC190243H_03104) 384156..384542 + 387 WP_000703163.1 VOC family protein -
OC617_RS15680 (CNRVC190243H_03105) 384799..385002 + 204 WP_001911580.1 hypothetical protein -
OC617_RS15685 (CNRVC190243H_03106) 385197..385448 + 252 WP_001890111.1 TIGR03643 family protein -
OC617_RS15690 385421..385570 + 150 WP_071908333.1 DUF3265 domain-containing protein -
OC617_RS15695 (CNRVC190243H_03107) 385717..386142 + 426 WP_000415750.1 hypothetical protein -
OC617_RS15700 (CNRVC190243H_03108) 386348..386971 + 624 WP_000247070.1 DUF1349 domain-containing protein -
OC617_RS15705 (CNRVC190243H_03109) 387184..387663 + 480 WP_000009888.1 lecithin retinol acyltransferase family protein -
OC617_RS15710 387660..387776 + 117 WP_086010882.1 DUF3265 domain-containing protein -
OC617_RS15715 (CNRVC190243H_03110) 387851..388264 + 414 WP_000049420.1 VOC family protein -
OC617_RS15720 (CNRVC190243H_03111) 388415..388693 - 279 WP_000578476.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
OC617_RS15725 (CNRVC190243H_03112) 388690..388974 - 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OC617_RS15730 (CNRVC190243H_03113) 389223..389684 + 462 WP_001911578.1 lipocalin family protein -
OC617_RS15735 (CNRVC190243H_03114) 389749..390345 + 597 WP_000255434.1 hypothetical protein -
OC617_RS15740 390539..390676 + 138 WP_001890145.1 hypothetical protein -
OC617_RS15745 390737..390919 + 183 WP_000923182.1 DUF645 family protein -
OC617_RS15750 (CNRVC190243H_03115) 391119..391592 + 474 WP_001161076.1 GrpB family protein -
OC617_RS15755 391607..391699 + 93 WP_014378730.1 DUF3265 domain-containing protein -
OC617_RS15760 (CNRVC190243H_03116) 391741..392367 + 627 WP_000365424.1 LysE family translocator -
OC617_RS15765 (CNRVC190243H_03117) 392490..393188 + 699 WP_001890502.1 hypothetical protein -
OC617_RS15770 393219..393308 + 90 WP_072606010.1 DUF3265 domain-containing protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 93 a.a.        Molecular weight: 10819.59 Da        Isoelectric Point: 5.1651

>T295390 WP_000578476.1 NZ_OW443148:c388693-388415 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Download         Length: 279 bp


Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10901.25 Da        Isoelectric Point: 8.0775

>AT295390 WP_000381183.1 NZ_OW443148:c388974-388690 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Download         Length: 285 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB Q9K2M8


Antitoxin

Source ID Structure
AlphaFold DB A0A067BL33

References