Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-Phd |
| Location | 425625..426172 | Replicon | chromosome |
| Accession | NZ_LT907990 | ||
| Organism | Vibrio cholerae strain A19 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q9KM92 |
| Locus tag | ALC86_RS16520 | Protein ID | WP_000229317.1 |
| Coordinates | 425870..426172 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9KM93 |
| Locus tag | ALC86_RS16515 | Protein ID | WP_000861987.1 |
| Coordinates | 425625..425882 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ALC86_RS16450 | 420654..421109 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
| ALC86_RS16460 | 421431..421583 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
| ALC86_RS16470 | 421785..422282 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
| ALC86_RS16475 | 422279..422551 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
| ALC86_RS16485 | 422782..423450 | + | 669 | WP_000043871.1 | hypothetical protein | - |
| ALC86_RS16490 | 423602..423889 | + | 288 | WP_000426470.1 | hypothetical protein | - |
| ALC86_RS16495 | 424030..424401 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
| ALC86_RS19780 | 424468..424893 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
| ALC86_RS16505 | 424890..425423 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
| ALC86_RS16515 | 425625..425882 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| ALC86_RS16520 | 425870..426172 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ALC86_RS16525 | 426406..427323 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
| ALC86_RS16535 | 427480..427869 | + | 390 | WP_001081302.1 | hypothetical protein | - |
| ALC86_RS16540 | 428005..428214 | + | 210 | Protein_466 | GNAT family N-acetyltransferase | - |
| ALC86_RS16545 | 428333..428770 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
| ALC86_RS16550 | 428834..429052 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
| ALC86_RS16555 | 429227..430099 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
| ALC86_RS16560 | 430249..430848 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
| ALC86_RS19615 | 430905..431009 | + | 105 | WP_099607150.1 | acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
| inside | Integron | catB9 | - | 309746..435385 | 125639 | ||
| flank | IS/Tn | - | - | 428333..428770 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T293835 WP_000229317.1 NZ_LT907990:425870-426172 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9KM92 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1T4SLM9 |