Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 331975..332473 | Replicon | chromosome |
Accession | NZ_CP025937 | ||
Organism | Vibrio cholerae strain A1552 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | C1H56_RS15840 | Protein ID | WP_000589156.1 |
Coordinates | 331975..332241 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | C1H56_RS15845 | Protein ID | WP_000643598.1 |
Coordinates | 332228..332473 (+) | Length | 82 a.a. |
Genomic Context
Location: 327395..327601 (207 bp)
Type: Others
Protein ID: Protein_290
Type: Others
Protein ID: Protein_290
Location: 327801..327902 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 327892..328278 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 328473..328724 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 328697..328846 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 328938..329180 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 329387..329710 (324 bp)
Type: Others
Protein ID: WP_001890134.1
Type: Others
Protein ID: WP_001890134.1
Location: 330085..330228 (144 bp)
Type: Others
Protein ID: Protein_297
Type: Others
Protein ID: Protein_297
Location: 330282..330320 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 330532..330999 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 331127..331790 (664 bp)
Type: Others
Protein ID: Protein_300
Type: Others
Protein ID: Protein_300
Location: 331975..332241 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 332228..332473 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 332569..333363 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 333466..333594 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 333655..333837 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 334053..335057 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 335210..335569 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 335842..336075 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 336343..336849 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 337006..337392 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1H56_RS19835 | 327395..327601 | + | 207 | Protein_290 | DUF3709 domain-containing protein | - |
C1H56_RS15785 | 327801..327902 | + | 102 | WP_001921603.1 | hypothetical protein | - |
C1H56_RS15790 | 327892..328278 | + | 387 | WP_000703163.1 | VOC family protein | - |
C1H56_RS15795 | 328473..328724 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
C1H56_RS15800 | 328697..328846 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
C1H56_RS15805 | 328938..329180 | + | 243 | WP_000107461.1 | hypothetical protein | - |
C1H56_RS15810 | 329387..329710 | + | 324 | WP_001890134.1 | DUF3709 domain-containing protein | - |
C1H56_RS19945 | 330085..330228 | + | 144 | Protein_297 | DUF645 family protein | - |
C1H56_RS19950 | 330282..330320 | + | 39 | WP_082798268.1 | hypothetical protein | - |
C1H56_RS15825 | 330532..330999 | + | 468 | WP_001289288.1 | OsmC family protein | - |
C1H56_RS15830 | 331127..331790 | + | 664 | Protein_300 | hypothetical protein | - |
C1H56_RS15840 | 331975..332241 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
C1H56_RS15845 | 332228..332473 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
C1H56_RS15850 | 332569..333363 | + | 795 | WP_001911581.1 | hypothetical protein | - |
C1H56_RS19955 | 333466..333594 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
C1H56_RS15865 | 333655..333837 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
C1H56_RS15870 | 334053..335057 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
C1H56_RS15875 | 335210..335569 | + | 360 | WP_001071541.1 | VOC family protein | - |
C1H56_RS15880 | 335842..336075 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
C1H56_RS15885 | 336343..336849 | + | 507 | WP_000393074.1 | hypothetical protein | - |
C1H56_RS15890 | 337006..337392 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304067..433328 | 129261 | |
inside | Integron | catB9 | - | 309147..432952 | 123805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T92505 WP_000589156.1 NZ_CP025937:331975-332241 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T92505 NZ_CP025937:331975-332241 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT92505 WP_000643598.1 NZ_CP025937:332228-332473 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT92505 NZ_CP025937:332228-332473 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |