Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 910495..910993 | Replicon | chromosome |
Accession | NZ_CP040173 | ||
Organism | Vibrio cholerae strain VC1374 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | FDZ90_RS18770 | Protein ID | WP_000589156.1 |
Coordinates | 910495..910761 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | FDZ90_RS18775 | Protein ID | WP_000643598.1 |
Coordinates | 910748..910993 (+) | Length | 82 a.a. |
Genomic Context
Location: 905916..906122 (207 bp)
Type: Others
Protein ID: Protein_796
Type: Others
Protein ID: Protein_796
Location: 906322..906423 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 906413..906799 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 906994..907245 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 907218..907367 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 907459..907701 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 907953..908231 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 908606..908749 (144 bp)
Type: Others
Protein ID: Protein_803
Type: Others
Protein ID: Protein_803
Location: 908803..908841 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 909053..909520 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 909648..910310 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 910495..910761 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 910748..910993 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 911089..911883 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 911986..912114 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 912175..912357 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 912557..913030 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 913027..913137 (111 bp)
Type: Others
Protein ID: WP_071908312.1
Type: Others
Protein ID: WP_071908312.1
Location: 913179..913805 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 913928..914626 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 914630..914746 (117 bp)
Type: Others
Protein ID: WP_071908339.1
Type: Others
Protein ID: WP_071908339.1
Location: 915324..915503 (180 bp)
Type: Others
Protein ID: WP_001883058.1
Type: Others
Protein ID: WP_001883058.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FDZ90_RS18715 | 905916..906122 | + | 207 | Protein_796 | DUF3709 domain-containing protein | - |
FDZ90_RS18720 | 906322..906423 | + | 102 | WP_001921603.1 | hypothetical protein | - |
FDZ90_RS18725 | 906413..906799 | + | 387 | WP_000703163.1 | VOC family protein | - |
FDZ90_RS18730 | 906994..907245 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
FDZ90_RS18735 | 907218..907367 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
FDZ90_RS18740 | 907459..907701 | + | 243 | WP_000107461.1 | hypothetical protein | - |
FDZ90_RS18745 | 907953..908231 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
FDZ90_RS18750 | 908606..908749 | + | 144 | Protein_803 | DUF645 family protein | - |
FDZ90_RS18755 | 908803..908841 | + | 39 | WP_082798268.1 | hypothetical protein | - |
FDZ90_RS18760 | 909053..909520 | + | 468 | WP_001289288.1 | OsmC family protein | - |
FDZ90_RS18765 | 909648..910310 | + | 663 | WP_000960654.1 | hypothetical protein | - |
FDZ90_RS18770 | 910495..910761 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
FDZ90_RS18775 | 910748..910993 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
FDZ90_RS18780 | 911089..911883 | + | 795 | WP_001911581.1 | hypothetical protein | - |
FDZ90_RS18785 | 911986..912114 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
FDZ90_RS18790 | 912175..912357 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
FDZ90_RS18795 | 912557..913030 | + | 474 | WP_001161076.1 | GrpB family protein | - |
FDZ90_RS18800 | 913027..913137 | + | 111 | WP_071908312.1 | DUF3265 domain-containing protein | - |
FDZ90_RS18805 | 913179..913805 | + | 627 | WP_000365424.1 | LysE family translocator | - |
FDZ90_RS18810 | 913928..914626 | + | 699 | WP_001890502.1 | hypothetical protein | - |
FDZ90_RS18815 | 914630..914746 | + | 117 | WP_071908339.1 | DUF3265 domain-containing protein | - |
FDZ90_RS18820 | 915324..915503 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 882589..977840 | 95251 | |
inside | Integron | catB9 | - | 887669..977464 | 89795 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T125039 WP_000589156.1 NZ_CP040173:910495-910761 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T125039 NZ_CP040173:910495-910761 [Vibrio cholerae]
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
ATGATTAAATTTGAATTTGATGAAAACAAAAGCAGAAGTAATCTCGAAAAGCACGGTATTGATTTTCATACAGCTCAAGG
ATTGTGGAATGATTCAGATCTTATCGAGATCCCTGCTAACACGAGTGATGAGCCCAGATATTTGGTTGTCGGCTTACTAA
ACGGTAAGCATTGGTCAGGAGTAATTACCTACCGAGGTACGAATATCAGGATCATCTCAGTTCGGCGTTCACGGAAAGCG
GAGGTAAGCCTTTATGAAAGCGCATGA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9478.77 Da Isoelectric Point: 6.4832
>AT125039 WP_000643598.1 NZ_CP040173:910748-910993 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT125039 NZ_CP040173:910748-910993 [Vibrio cholerae]
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
ATGAAAGCGCATGAATTTGATGCCAAGTTTGAAAGTGACGACGATGATATCGTAATGGACTTGGATCTATCGCAAGCTAA
AAGACCGATGCATAAGCAAAAACGAGTCAATGTAGATTTTCCAGCCTGGATGCTTGAGTCCTTGGACAGAGAAGCGAGTC
GTATTGGTGTAACACGTCAATCAATCATTAAAATTTGGCTGGCAGAAAGGTTAGAGAGCGTGTCTCATCATTCAAGTGTG
AGATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |