Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 54322..54862 | Replicon | chromosome |
Accession | NZ_CP007635 | ||
Organism | Vibrio cholerae strain 2012EL-2176 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | EN18_RS14435 | Protein ID | WP_000277238.1 |
Coordinates | 54322..54591 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | EN18_RS14440 | Protein ID | WP_001258569.1 |
Coordinates | 54584..54862 (-) | Length | 93 a.a. |
Genomic Context
Location: 49543..50079 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 50216..50731 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 52040..52165 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 52181..52219 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 52415..52861 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 52924..54135 (1212 bp)
Type: Others
Protein ID: WP_001122813.1
Type: Others
Protein ID: WP_001122813.1
Location: 55148..55426 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 55678..55884 (207 bp)
Type: Others
Protein ID: Protein_69
Type: Others
Protein ID: Protein_69
Location: 56084..56185 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 56175..56561 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 56756..57007 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 56980..57129 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 57221..57463 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 57715..57993 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 58368..58511 (144 bp)
Type: Others
Protein ID: Protein_76
Type: Others
Protein ID: Protein_76
Location: 58565..58603 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 58815..59282 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 50881..51378 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 51375..51647 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 54322..54591 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 54584..54862 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EN18_RS14395 | 49543..50079 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
EN18_RS14400 | 50216..50731 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
EN18_RS14405 | 50881..51378 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
EN18_RS14410 | 51375..51647 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
EN18_RS21085 | 52040..52165 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
EN18_RS21090 | 52181..52219 | + | 39 | WP_106019118.1 | hypothetical protein | - |
EN18_RS14425 | 52415..52861 | + | 447 | WP_000006157.1 | hypothetical protein | - |
EN18_RS14430 | 52924..54135 | + | 1212 | WP_001122813.1 | IS256 family transposase | - |
EN18_RS14435 | 54322..54591 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
EN18_RS14440 | 54584..54862 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
EN18_RS20510 | 55148..55426 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
EN18_RS21105 | 55678..55884 | + | 207 | Protein_69 | DUF3709 domain-containing protein | - |
EN18_RS21110 | 56084..56185 | + | 102 | WP_001921603.1 | hypothetical protein | - |
EN18_RS14450 | 56175..56561 | + | 387 | WP_000703163.1 | VOC family protein | - |
EN18_RS14455 | 56756..57007 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
EN18_RS20520 | 56980..57129 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
EN18_RS14460 | 57221..57463 | + | 243 | WP_000107461.1 | hypothetical protein | - |
EN18_RS14465 | 57715..57993 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
EN18_RS21540 | 58368..58511 | + | 144 | Protein_76 | DUF645 family protein | - |
EN18_RS21545 | 58565..58603 | + | 39 | WP_082798268.1 | hypothetical protein | - |
EN18_RS14475 | 58815..59282 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31037..137542 | 106505 | |
inside | Integron | - | - | 36117..137166 | 101049 | ||
- | flank | IS/Tn | - | - | 52924..54135 | 1211 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T46751 WP_000277238.1 NZ_CP007635:c54591-54322 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T46751 NZ_CP007635:c54591-54322 [Vibrio cholerae]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT46751 WP_001258569.1 NZ_CP007635:c54862-54584 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT46751 NZ_CP007635:c54862-54584 [Vibrio cholerae]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |