Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 206207..206735 | Replicon | chromosome |
Accession | NZ_CP013316 | ||
Organism | Vibrio cholerae strain M2140 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | ASZ83_RS15485 | Protein ID | WP_000221354.1 |
Coordinates | 206448..206735 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | ASZ83_RS15480 | Protein ID | WP_001250179.1 |
Coordinates | 206207..206458 (+) | Length | 84 a.a. |
Genomic Context
Location: 201261..201299 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 201512..202516 (1005 bp)
Type: Others
Protein ID: WP_000964925.1
Type: Others
Protein ID: WP_000964925.1
Location: 202669..203115 (447 bp)
Type: Others
Protein ID: WP_000128977.1
Type: Others
Protein ID: WP_000128977.1
Location: 203235..204164 (930 bp)
Type: Others
Protein ID: WP_000335802.1
Type: Others
Protein ID: WP_000335802.1
Location: 204161..204271 (111 bp)
Type: Others
Protein ID: WP_071917832.1
Type: Others
Protein ID: WP_071917832.1
Location: 204299..204991 (693 bp)
Type: Others
Protein ID: WP_001047177.1
Type: Others
Protein ID: WP_001047177.1
Location: 204991..205392 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 205362..205505 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 205580..205993 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 206207..206458 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 206448..206735 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 206863..207318 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 207640..207792 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 208991..209659 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 209811..210098 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 210239..210610 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 210677..211102 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 211099..211632 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 207994..208491 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 208488..208760 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ83_RS20485 | 201261..201299 | + | 39 | WP_106019119.1 | hypothetical protein | - |
ASZ83_RS15440 | 201512..202516 | + | 1005 | WP_000964925.1 | LD-carboxypeptidase | - |
ASZ83_RS15445 | 202669..203115 | + | 447 | WP_000128977.1 | hypothetical protein | - |
ASZ83_RS15450 | 203235..204164 | + | 930 | WP_000335802.1 | hypothetical protein | - |
ASZ83_RS20210 | 204161..204271 | + | 111 | WP_071917832.1 | DUF3265 domain-containing protein | - |
ASZ83_RS15460 | 204299..204991 | + | 693 | WP_001047177.1 | GNAT family N-acetyltransferase | - |
ASZ83_RS15465 | 204991..205392 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
ASZ83_RS20215 | 205362..205505 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
ASZ83_RS15475 | 205580..205993 | + | 414 | WP_000049417.1 | VOC family protein | - |
ASZ83_RS15480 | 206207..206458 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ASZ83_RS15485 | 206448..206735 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ83_RS15490 | 206863..207318 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
ASZ83_RS15500 | 207640..207792 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
ASZ83_RS15505 | 207994..208491 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
ASZ83_RS15510 | 208488..208760 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
ASZ83_RS15515 | 208991..209659 | + | 669 | WP_000043871.1 | hypothetical protein | - |
ASZ83_RS15520 | 209811..210098 | + | 288 | WP_000426470.1 | hypothetical protein | - |
ASZ83_RS15525 | 210239..210610 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
ASZ83_RS15530 | 210677..211102 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
ASZ83_RS15535 | 211099..211632 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 87981..224211 | 136230 | |
inside | Integron | - | - | 93061..221594 | 128533 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T58383 WP_000221354.1 NZ_CP013316:206448-206735 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T58383 NZ_CP013316:206448-206735 [Vibrio cholerae]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT58383 WP_001250179.1 NZ_CP013316:206207-206458 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT58383 NZ_CP013316:206207-206458 [Vibrio cholerae]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |