Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 326606..327146 | Replicon | chromosome |
Accession | NZ_CP090379 | ||
Organism | Vibrio cholerae strain BY369 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | LVJ30_RS15280 | Protein ID | WP_000277238.1 |
Coordinates | 326606..326875 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | LVJ30_RS15285 | Protein ID | WP_001258569.1 |
Coordinates | 326868..327146 (-) | Length | 93 a.a. |
Genomic Context
Location: 322096..322482 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 322539..322652 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 322661..322882 (222 bp)
Type: Others
Protein ID: WP_032467793.1
Type: Others
Protein ID: WP_032467793.1
Location: 323140..323676 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 323867..324328 (462 bp)
Type: Others
Protein ID: WP_001903091.1
Type: Others
Protein ID: WP_001903091.1
Location: 324393..324461 (69 bp)
Type: Others
Protein ID: Protein_284
Type: Others
Protein ID: Protein_284
Location: 325637..325762 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 326012..326458 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 327197..327314 (118 bp)
Type: Others
Protein ID: Protein_291
Type: Others
Protein ID: Protein_291
Location: 327432..327710 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 328070..328168 (99 bp)
Type: Others
Protein ID: WP_223225486.1
Type: Others
Protein ID: WP_223225486.1
Location: 328368..328469 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 328459..328845 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 329040..329291 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 329264..329413 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 329505..329747 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 329999..330277 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 330709..330752 (44 bp)
Type: Others
Protein ID: Protein_300
Type: Others
Protein ID: Protein_300
Location: 330734..330827 (94 bp)
Type: Others
Protein ID: Protein_301
Type: Others
Protein ID: Protein_301
Location: 330796..330927 (132 bp)
Type: Others
Protein ID: WP_001883067.1
Type: Others
Protein ID: WP_001883067.1
Location: 331099..331566 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 321610..321852 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 324478..324975 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 324972..325244 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 326606..326875 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 326868..327146 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LVJ30_RS15225 (LVJ30_15230) | 321610..321852 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
LVJ30_RS15230 (LVJ30_15235) | 322096..322482 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
LVJ30_RS15235 (LVJ30_15240) | 322539..322652 | + | 114 | WP_001900214.1 | hypothetical protein | - |
LVJ30_RS15240 (LVJ30_15245) | 322661..322882 | + | 222 | WP_032467793.1 | DUF1289 domain-containing protein | - |
LVJ30_RS15245 (LVJ30_15250) | 323140..323676 | + | 537 | WP_000469482.1 | GNAT family protein | - |
LVJ30_RS15250 (LVJ30_15255) | 323867..324328 | + | 462 | WP_001903091.1 | lipocalin family protein | - |
LVJ30_RS15255 (LVJ30_15260) | 324393..324461 | + | 69 | Protein_284 | acetyltransferase | - |
LVJ30_RS15260 (LVJ30_15265) | 324478..324975 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
LVJ30_RS15265 (LVJ30_15270) | 324972..325244 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
LVJ30_RS15270 (LVJ30_15275) | 325637..325762 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
LVJ30_RS15275 (LVJ30_15280) | 326012..326458 | + | 447 | WP_000006157.1 | hypothetical protein | - |
LVJ30_RS15280 (LVJ30_15285) | 326606..326875 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
LVJ30_RS15285 (LVJ30_15290) | 326868..327146 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LVJ30_RS15290 (LVJ30_15295) | 327197..327314 | + | 118 | Protein_291 | DUF3265 domain-containing protein | - |
LVJ30_RS15295 (LVJ30_15300) | 327432..327710 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
LVJ30_RS15300 (LVJ30_15305) | 328070..328168 | + | 99 | WP_223225486.1 | DUF3709 domain-containing protein | - |
LVJ30_RS15305 (LVJ30_15310) | 328368..328469 | + | 102 | WP_001921603.1 | hypothetical protein | - |
LVJ30_RS15310 (LVJ30_15315) | 328459..328845 | + | 387 | WP_000703163.1 | VOC family protein | - |
LVJ30_RS15315 (LVJ30_15320) | 329040..329291 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
LVJ30_RS15320 (LVJ30_15325) | 329264..329413 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
LVJ30_RS15325 (LVJ30_15330) | 329505..329747 | + | 243 | WP_000107461.1 | hypothetical protein | - |
LVJ30_RS15330 (LVJ30_15335) | 329999..330277 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
LVJ30_RS15335 (LVJ30_15340) | 330709..330752 | + | 44 | Protein_300 | hypothetical protein | - |
LVJ30_RS15340 (LVJ30_15345) | 330734..330827 | + | 94 | Protein_301 | ggdef family protein | - |
LVJ30_RS15345 (LVJ30_15350) | 330796..330927 | + | 132 | WP_001883067.1 | hypothetical protein | - |
LVJ30_RS15350 (LVJ30_15355) | 331099..331566 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304645..399892 | 95247 | |
inside | Integron | - | - | 309725..399516 | 89791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T230517 WP_000277238.1 NZ_CP090379:c326875-326606 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T230517 NZ_CP124916:592373-592489 [Enterococcus faecalis]
ATGTTTTTGTCCGTTGAAGCAGCGCTAGGACTGATGATTGGTTTTGCAACACTTGTTGTGACCATTATCTTCGGTATCTT
AGCGCTTGTCTTAGACAACAAAAATAACCGTTCATAA
ATGTTTTTGTCCGTTGAAGCAGCGCTAGGACTGATGATTGGTTTTGCAACACTTGTTGTGACCATTATCTTCGGTATCTT
AGCGCTTGTCTTAGACAACAAAAATAACCGTTCATAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT230517 WP_001258569.1 NZ_CP090379:c327146-326868 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT230517 NZ_CP124916:c592605-592400 [Enterococcus faecalis]
AAAAGAGAGATATGCAGGAACATACCTCTCTAATAGCCACTACTAGTTATAAGAACTAGCGGCTTACTGAGTTATTGGTT
TTATTTCAAACGCTTAACCGTTCAGCTCCTCAAAGCTTATGAACGGTTATTTTTGTTGTCTAAGACAAGCGCTAAGATAC
CGAAGATAATGGTCACAACAAGTGTTGCAAAACCAATCATCAGTCC
AAAAGAGAGATATGCAGGAACATACCTCTCTAATAGCCACTACTAGTTATAAGAACTAGCGGCTTACTGAGTTATTGGTT
TTATTTCAAACGCTTAACCGTTCAGCTCCTCAAAGCTTATGAACGGTTATTTTTGTTGTCTAAGACAAGCGCTAAGATAC
CGAAGATAATGGTCACAACAAGTGTTGCAAAACCAATCATCAGTCC
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |