Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 94424..95039 | Replicon | chromosome |
Accession | NZ_CP026648 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain HC1037 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMG5 |
Locus tag | C4E16_RS14895 | Protein ID | WP_001162670.1 |
Coordinates | 94424..94711 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | C4E16_RS14900 | Protein ID | WP_001232701.1 |
Coordinates | 94722..95039 (+) | Length | 106 a.a. |
Genomic Context
Location: 90060..90155 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 91169..91678 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 91735..92388 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 92698..92916 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 93319..93552 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 93977..94157 (181 bp)
Type: Others
Protein ID: Protein_139
Type: Others
Protein ID: Protein_139
Location: 94424..94711 (288 bp)
Type: Toxin
Protein ID: WP_001162670.1
Type: Toxin
Protein ID: WP_001162670.1
Location: 94722..95039 (318 bp)
Type: Antitoxin
Protein ID: WP_001232701.1
Type: Antitoxin
Protein ID: WP_001232701.1
Location: 95036..95146 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 95323..95448 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 95464..95502 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 95715..96719 (1005 bp)
Type: Others
Protein ID: WP_000964925.1
Type: Others
Protein ID: WP_000964925.1
Location: 96872..97318 (447 bp)
Type: Others
Protein ID: WP_000128977.1
Type: Others
Protein ID: WP_000128977.1
Location: 97438..98367 (930 bp)
Type: Others
Protein ID: WP_000335802.1
Type: Others
Protein ID: WP_000335802.1
Location: 98364..98474 (111 bp)
Type: Others
Protein ID: WP_071917832.1
Type: Others
Protein ID: WP_071917832.1
Location: 98502..98978 (477 bp)
Type: Others
Protein ID: WP_001047180.1
Type: Others
Protein ID: WP_001047180.1
Location: 99115..99630 (516 bp)
Type: Others
Protein ID: WP_001201528.1
Type: Others
Protein ID: WP_001201528.1
Location: 90349..90666 (318 bp)
Type: Others
Protein ID: WP_001180243.1
Type: Others
Protein ID: WP_001180243.1
Location: 90685..90927 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C4E16_RS19565 | 90060..90155 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
C4E16_RS14855 | 90349..90666 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
C4E16_RS14860 | 90685..90927 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
C4E16_RS14865 | 91169..91678 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
C4E16_RS14870 | 91735..92388 | + | 654 | WP_000226874.1 | hypothetical protein | - |
C4E16_RS14875 | 92698..92916 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
C4E16_RS14880 | 93319..93552 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
C4E16_RS14885 | 93977..94157 | + | 181 | Protein_139 | DUF645 family protein | - |
C4E16_RS14895 | 94424..94711 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C4E16_RS14900 | 94722..95039 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | Antitoxin |
C4E16_RS19570 | 95036..95146 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
C4E16_RS14915 | 95323..95448 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
C4E16_RS19440 | 95464..95502 | + | 39 | WP_106019119.1 | hypothetical protein | - |
C4E16_RS14925 | 95715..96719 | + | 1005 | WP_000964925.1 | LD-carboxypeptidase | - |
C4E16_RS14930 | 96872..97318 | + | 447 | WP_000128977.1 | hypothetical protein | - |
C4E16_RS14935 | 97438..98367 | + | 930 | WP_000335802.1 | hypothetical protein | - |
C4E16_RS14940 | 98364..98474 | + | 111 | WP_071917832.1 | DUF3265 domain-containing protein | - |
C4E16_RS14945 | 98502..98978 | + | 477 | WP_001047180.1 | GNAT family N-acetyltransferase | - |
C4E16_RS14950 | 99115..99630 | + | 516 | WP_001201528.1 | lipocalin family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31043..136234 | 105191 | |
inside | Integron | - | - | 36123..135858 | 99735 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11349.95 Da Isoelectric Point: 6.7187
>T95382 WP_001162670.1 NZ_CP026648:94424-94711 [Vibrio cholerae O1 biovar El Tor]
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQW
VDGVALNTYLDPHKY
Download Length: 288 bp
>T95382 NZ_CP026648:94424-94711 [Vibrio cholerae O1 biovar El Tor]
ATGGCATTAGAATTTAAAGATAAGTGGTTAGAGCAGTTTTACGAGGATGATAAACGACATCGTTTAATTCCAAGTAGCAT
AGAGAATGCTCTATTTCGGAAGCTGGAAATCTTAGATGCAGCTCAAGCTGAATCAGACTTAAGAATTCCACCGGGTAATC
GTTTTGAACATCTTGAAGGAAATCTTAAAGGTTGGTGTTCAATTCGAGTGAACAAACAGTATCGTTTGATTTTTCAGTGG
GTTGATGGTGTTGCACTAAATACTTACTTAGACCCACATAAGTATTGA
ATGGCATTAGAATTTAAAGATAAGTGGTTAGAGCAGTTTTACGAGGATGATAAACGACATCGTTTAATTCCAAGTAGCAT
AGAGAATGCTCTATTTCGGAAGCTGGAAATCTTAGATGCAGCTCAAGCTGAATCAGACTTAAGAATTCCACCGGGTAATC
GTTTTGAACATCTTGAAGGAAATCTTAAAGGTTGGTGTTCAATTCGAGTGAACAAACAGTATCGTTTGATTTTTCAGTGG
GTTGATGGTGTTGCACTAAATACTTACTTAGACCCACATAAGTATTGA
Antitoxin
Download Length: 106 a.a. Molecular weight: 11705.63 Da Isoelectric Point: 10.4711
>AT95382 WP_001232701.1 NZ_CP026648:94722-95039 [Vibrio cholerae O1 biovar El Tor]
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWD
TRNRYQEEAKFVKPLFVSLEQSART
Download Length: 318 bp
>AT95382 NZ_CP026648:94722-95039 [Vibrio cholerae O1 biovar El Tor]
ATGCGTAAGACAAAACGTCGTCCAGTTAGCGTTGGGGAAATGTTAAAAGTTGAATTTCTTGAACCAATGGGCATCACATC
AAAAGCGCTCGCTGAAGCGATGGGCGTACACAGAAATACGGTCAGTAATTTAATTAATGGTGGTGTGTTAACAGCTCCGG
TAGCAATCAAGTTAGCCGCGGCATTAGGTAACACACCAGAATTTTGGCTTAACATTCAACATGCAGTTGATCTTTGGGAT
ACGAGAAATCGTTATCAAGAAGAAGCAAAGTTTGTAAAGCCGTTGTTTGTTTCGCTGGAACAAAGCGCACGTACATAA
ATGCGTAAGACAAAACGTCGTCCAGTTAGCGTTGGGGAAATGTTAAAAGTTGAATTTCTTGAACCAATGGGCATCACATC
AAAAGCGCTCGCTGAAGCGATGGGCGTACACAGAAATACGGTCAGTAATTTAATTAATGGTGGTGTGTTAACAGCTCCGG
TAGCAATCAAGTTAGCCGCGGCATTAGGTAACACACCAGAATTTTGGCTTAACATTCAACATGCAGTTGATCTTTGGGAT
ACGAGAAATCGTTATCAAGAAGAAGCAAAGTTTGTAAAGCCGTTGTTTGTTTCGCTGGAACAAAGCGCACGTACATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F2HI36 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |