Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 333949..334447 | Replicon | chromosome |
Accession | NZ_LT906615 | ||
Organism | Vibrio cholerae O1 biovar El Tor str. N16961 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9KMK7 |
Locus tag | FY484_RS15495 | Protein ID | WP_000589156.1 |
Coordinates | 333949..334215 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9KMK6 |
Locus tag | FY484_RS15500 | Protein ID | WP_000643598.1 |
Coordinates | 334202..334447 (+) | Length | 82 a.a. |
Genomic Context
Location: 329370..329576 (207 bp)
Type: Others
Protein ID: Protein_292
Type: Others
Protein ID: Protein_292
Location: 329776..329877 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 329867..330253 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 330448..330699 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 330672..330821 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 330913..331155 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 331407..331685 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 332060..332203 (144 bp)
Type: Others
Protein ID: Protein_299
Type: Others
Protein ID: Protein_299
Location: 332257..332295 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 332507..332974 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 333102..333764 (663 bp)
Type: Others
Protein ID: WP_000960654.1
Type: Others
Protein ID: WP_000960654.1
Location: 333949..334215 (267 bp)
Type: Toxin
Protein ID: WP_000589156.1
Type: Toxin
Protein ID: WP_000589156.1
Location: 334202..334447 (246 bp)
Type: Antitoxin
Protein ID: WP_000643598.1
Type: Antitoxin
Protein ID: WP_000643598.1
Location: 334543..335337 (795 bp)
Type: Others
Protein ID: WP_001911581.1
Type: Others
Protein ID: WP_001911581.1
Location: 335440..335568 (129 bp)
Type: Others
Protein ID: WP_071908338.1
Type: Others
Protein ID: WP_071908338.1
Location: 335629..335811 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 336027..337031 (1005 bp)
Type: Others
Protein ID: WP_000964920.1
Type: Others
Protein ID: WP_000964920.1
Location: 337184..337543 (360 bp)
Type: Others
Protein ID: WP_001071541.1
Type: Others
Protein ID: WP_001071541.1
Location: 337816..338049 (234 bp)
Type: Others
Protein ID: WP_001890112.1
Type: Others
Protein ID: WP_001890112.1
Location: 338317..338823 (507 bp)
Type: Others
Protein ID: WP_000393074.1
Type: Others
Protein ID: WP_000393074.1
Location: 338980..339366 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FY484_RS15435 | 329370..329576 | + | 207 | Protein_292 | DUF3709 domain-containing protein | - |
FY484_RS15440 | 329776..329877 | + | 102 | WP_001921603.1 | hypothetical protein | - |
FY484_RS15445 | 329867..330253 | + | 387 | WP_000703163.1 | VOC family protein | - |
FY484_RS15450 | 330448..330699 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
FY484_RS15455 | 330672..330821 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
FY484_RS15460 | 330913..331155 | + | 243 | WP_000107461.1 | hypothetical protein | - |
FY484_RS15465 | 331407..331685 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
FY484_RS19505 | 332060..332203 | + | 144 | Protein_299 | DUF645 family protein | - |
FY484_RS19510 | 332257..332295 | + | 39 | WP_082798268.1 | hypothetical protein | - |
FY484_RS15480 | 332507..332974 | + | 468 | WP_001289288.1 | OsmC family protein | - |
FY484_RS15485 | 333102..333764 | + | 663 | WP_000960654.1 | hypothetical protein | - |
FY484_RS15495 | 333949..334215 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
FY484_RS15500 | 334202..334447 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
FY484_RS15505 | 334543..335337 | + | 795 | WP_001911581.1 | hypothetical protein | - |
FY484_RS15515 | 335440..335568 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
FY484_RS15520 | 335629..335811 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
FY484_RS15525 | 336027..337031 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
FY484_RS15530 | 337184..337543 | + | 360 | WP_001071541.1 | VOC family protein | - |
FY484_RS15535 | 337816..338049 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
FY484_RS15540 | 338317..338823 | + | 507 | WP_000393074.1 | hypothetical protein | - |
FY484_RS15545 | 338980..339366 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
inside | Integron | catB9 | - | 309746..435385 | 125639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T293795 WP_000589156.1 NZ_LT906615:333949-334215 [Vibrio cholerae O1 biovar El Tor str. N16961]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VMP7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A271VME2 |