Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /BrnT(toxin) |
| Location | 333949..334447 | Replicon | chromosome |
| Accession | NZ_LT906615 | ||
| Organism | Vibrio cholerae O1 biovar El Tor str. N16961 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | Q9KMK7 |
| Locus tag | FY484_RS15495 | Protein ID | WP_000589156.1 |
| Coordinates | 333949..334215 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | Q9KMK6 |
| Locus tag | FY484_RS15500 | Protein ID | WP_000643598.1 |
| Coordinates | 334202..334447 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FY484_RS15435 | 329370..329576 | + | 207 | Protein_292 | DUF3709 domain-containing protein | - |
| FY484_RS15440 | 329776..329877 | + | 102 | WP_001921603.1 | hypothetical protein | - |
| FY484_RS15445 | 329867..330253 | + | 387 | WP_000703163.1 | VOC family protein | - |
| FY484_RS15450 | 330448..330699 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
| FY484_RS15455 | 330672..330821 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
| FY484_RS15460 | 330913..331155 | + | 243 | WP_000107461.1 | hypothetical protein | - |
| FY484_RS15465 | 331407..331685 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
| FY484_RS19505 | 332060..332203 | + | 144 | Protein_299 | DUF645 family protein | - |
| FY484_RS19510 | 332257..332295 | + | 39 | WP_082798268.1 | hypothetical protein | - |
| FY484_RS15480 | 332507..332974 | + | 468 | WP_001289288.1 | OsmC family protein | - |
| FY484_RS15485 | 333102..333764 | + | 663 | WP_000960654.1 | hypothetical protein | - |
| FY484_RS15495 | 333949..334215 | + | 267 | WP_000589156.1 | BrnT family toxin | Toxin |
| FY484_RS15500 | 334202..334447 | + | 246 | WP_000643598.1 | hypothetical protein | Antitoxin |
| FY484_RS15505 | 334543..335337 | + | 795 | WP_001911581.1 | hypothetical protein | - |
| FY484_RS15515 | 335440..335568 | + | 129 | WP_071908338.1 | general secretion pathway protein GspI | - |
| FY484_RS15520 | 335629..335811 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
| FY484_RS15525 | 336027..337031 | + | 1005 | WP_000964920.1 | LD-carboxypeptidase | - |
| FY484_RS15530 | 337184..337543 | + | 360 | WP_001071541.1 | VOC family protein | - |
| FY484_RS15535 | 337816..338049 | + | 234 | WP_001890112.1 | DUF3709 domain-containing protein | - |
| FY484_RS15540 | 338317..338823 | + | 507 | WP_000393074.1 | hypothetical protein | - |
| FY484_RS15545 | 338980..339366 | + | 387 | WP_000703163.1 | VOC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 304666..435761 | 131095 | |
| inside | Integron | catB9 | - | 309746..435385 | 125639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10092.34 Da Isoelectric Point: 7.3171
>T293795 WP_000589156.1 NZ_LT906615:333949-334215 [Vibrio cholerae O1 biovar El Tor str. N16961]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A271VMP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A271VME2 |