293795

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 333949..334447 Replicon chromosome
Accession NZ_LT906615
Organism Vibrio cholerae O1 biovar El Tor str. N16961

Toxin (Protein)


Gene name - Uniprot ID Q9KMK7
Locus tag FY484_RS15495 Protein ID WP_000589156.1
Coordinates 333949..334215 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9KMK6
Locus tag FY484_RS15500 Protein ID WP_000643598.1
Coordinates 334202..334447 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FY484_RS15435 329370..329576 + 207 Protein_292 DUF3709 domain-containing protein -
FY484_RS15440 329776..329877 + 102 WP_001921603.1 hypothetical protein -
FY484_RS15445 329867..330253 + 387 WP_000703163.1 VOC family protein -
FY484_RS15450 330448..330699 + 252 WP_001890111.1 TIGR03643 family protein -
FY484_RS15455 330672..330821 + 150 WP_071908333.1 DUF3265 domain-containing protein -
FY484_RS15460 330913..331155 + 243 WP_000107461.1 hypothetical protein -
FY484_RS15465 331407..331685 + 279 WP_000280324.1 DUF3709 domain-containing protein -
FY484_RS19505 332060..332203 + 144 Protein_299 DUF645 family protein -
FY484_RS19510 332257..332295 + 39 WP_082798268.1 hypothetical protein -
FY484_RS15480 332507..332974 + 468 WP_001289288.1 OsmC family protein -
FY484_RS15485 333102..333764 + 663 WP_000960654.1 hypothetical protein -
FY484_RS15495 333949..334215 + 267 WP_000589156.1 BrnT family toxin Toxin
FY484_RS15500 334202..334447 + 246 WP_000643598.1 hypothetical protein Antitoxin
FY484_RS15505 334543..335337 + 795 WP_001911581.1 hypothetical protein -
FY484_RS15515 335440..335568 + 129 WP_071908338.1 general secretion pathway protein GspI -
FY484_RS15520 335629..335811 + 183 WP_000923182.1 DUF645 family protein -
FY484_RS15525 336027..337031 + 1005 WP_000964920.1 LD-carboxypeptidase -
FY484_RS15530 337184..337543 + 360 WP_001071541.1 VOC family protein -
FY484_RS15535 337816..338049 + 234 WP_001890112.1 DUF3709 domain-containing protein -
FY484_RS15540 338317..338823 + 507 WP_000393074.1 hypothetical protein -
FY484_RS15545 338980..339366 + 387 WP_000703163.1 VOC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10092.34 Da        Isoelectric Point: 7.3171

>T293795 WP_000589156.1 NZ_LT906615:333949-334215 [Vibrio cholerae O1 biovar El Tor str. N16961]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA

Download         Length: 267 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9478.77 Da        Isoelectric Point: 6.4832

>AT293795 WP_000643598.1 NZ_LT906615:334202-334447 [Vibrio cholerae O1 biovar El Tor str. N16961]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A271VMP7

Antitoxin

Source ID Structure
AlphaFold DB A0A271VME2

References