293834

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /DUF1778(antitoxin)
Location 424468..425423 Replicon chromosome
Accession NZ_LT907990
Organism Vibrio cholerae strain A19

Toxin (Protein)


Gene name - Uniprot ID Q9KM94
Locus tag ALC86_RS16505 Protein ID WP_000118351.1
Coordinates 424890..425423 (+) Length 178 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag ALC86_RS19780 Protein ID WP_001882332.1
Coordinates 424468..424893 (+) Length 142 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ALC86_RS16440 419998..420249 + 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
ALC86_RS16445 420239..420526 + 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin -
ALC86_RS16450 420654..421109 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
ALC86_RS16460 421431..421583 + 153 WP_001884520.1 DUF645 family protein -
ALC86_RS16470 421785..422282 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
ALC86_RS16475 422279..422551 - 273 WP_000246253.1 DUF1778 domain-containing protein -
ALC86_RS16485 422782..423450 + 669 WP_000043871.1 hypothetical protein -
ALC86_RS16490 423602..423889 + 288 WP_000426470.1 hypothetical protein -
ALC86_RS16495 424030..424401 + 372 WP_001164080.1 nucleotide pyrophosphohydrolase -
ALC86_RS19780 424468..424893 + 426 WP_001882332.1 DUF1778 domain-containing protein Antitoxin
ALC86_RS16505 424890..425423 + 534 WP_000118351.1 GNAT family N-acetyltransferase Toxin
ALC86_RS16515 425625..425882 + 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
ALC86_RS16520 425870..426172 + 303 WP_000229317.1 type II toxin-antitoxin system RelE/ParE family toxin -
ALC86_RS16525 426406..427323 + 918 WP_000186333.1 alpha/beta hydrolase -
ALC86_RS16535 427480..427869 + 390 WP_001081302.1 hypothetical protein -
ALC86_RS16540 428005..428214 + 210 Protein_466 GNAT family N-acetyltransferase -
ALC86_RS16545 428333..428770 + 438 WP_000503169.1 IS200/IS605-like element IS1004 family transposase -
ALC86_RS16550 428834..429052 + 219 WP_071908318.1 GNAT family N-acetyltransferase -
ALC86_RS16555 429227..430099 + 873 WP_000254716.1 DUF3800 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 304666..435761 131095
inside Integron catB9 - 309746..435385 125639
flank IS/Tn - - 428333..428770 437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(97-153)

Antitoxin

Vibrio phage ICP1, Orf50

(57-133)


Sequences

Toxin        


Download         Length: 178 a.a.        Molecular weight: 20171.46 Da        Isoelectric Point: 9.1432

>T293834 WP_000118351.1 NZ_LT907990:424890-425423 [Vibrio cholerae]
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAHPLLNQKFAICAFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMFLPMKTVEQLFNQ

Download         Length: 534 bp

Antitoxin


Download         Length: 142 a.a.        Molecular weight: 15714.41 Da        Isoelectric Point: 7.6659

>AT293834 WP_001882332.1 NZ_LT907990:424468-424893 [Vibrio cholerae]
MLCLSLVVMRCQPLRRALYSPSPRKLSVRIECALSLAYNRSTDGMYPYAGGVMATARLDIRLDEEIKAKAEKASALLGLK
SLTEYVVRLMDEDATHVIEEHESIMVKDSVFDEFMAACNKVKAPNQALLEAVKFTEKSGIK

Download         Length: 426 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q9KM94

Antitoxin

Source ID Structure

References