Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 273814..274352 | Replicon | chromosome |
Accession | NZ_AP024554 | ||
Organism | Vibrio cholerae strain IDH-03329 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | K6J80_RS15305 | Protein ID | WP_000802136.1 |
Coordinates | 274053..274352 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | K6J80_RS15300 | Protein ID | WP_001107719.1 |
Coordinates | 273814..274056 (+) | Length | 81 a.a. |
Genomic Context
Location: 273814..274056 (243 bp)
Type: Antitoxin
Protein ID: WP_001107719.1
Type: Antitoxin
Protein ID: WP_001107719.1
Location: 274053..274352 (300 bp)
Type: Toxin
Protein ID: WP_000802136.1
Type: Toxin
Protein ID: WP_000802136.1
Location: 269230..269370 (141 bp)
Type: Others
Protein ID: WP_001883049.1
Type: Others
Protein ID: WP_001883049.1
Location: 269336..270271 (936 bp)
Type: Others
Protein ID: WP_000051985.1
Type: Others
Protein ID: WP_000051985.1
Location: 270552..271151 (600 bp)
Type: Others
Protein ID: WP_000429495.1
Type: Others
Protein ID: WP_000429495.1
Location: 271306..271572 (267 bp)
Type: Others
Protein ID: WP_000937852.1
Type: Others
Protein ID: WP_000937852.1
Location: 271786..272469 (684 bp)
Type: Others
Protein ID: WP_000877436.1
Type: Others
Protein ID: WP_000877436.1
Location: 272893..272985 (93 bp)
Type: Others
Protein ID: WP_014164112.1
Type: Others
Protein ID: WP_014164112.1
Location: 273007..273585 (579 bp)
Type: Others
Protein ID: WP_000110120.1
Type: Others
Protein ID: WP_000110120.1
Location: 274480..274875 (396 bp)
Type: Others
Protein ID: WP_000870857.1
Type: Others
Protein ID: WP_000870857.1
Location: 275089..275268 (180 bp)
Type: Others
Protein ID: WP_001883058.1
Type: Others
Protein ID: WP_001883058.1
Location: 275846..275935 (90 bp)
Type: Others
Protein ID: WP_072606010.1
Type: Others
Protein ID: WP_072606010.1
Location: 275966..276664 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 276787..277413 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 277455..277547 (93 bp)
Type: Others
Protein ID: WP_014378730.1
Type: Others
Protein ID: WP_014378730.1
Location: 277562..278035 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 278235..278417 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 278478..278615 (138 bp)
Type: Others
Protein ID: WP_001890145.1
Type: Others
Protein ID: WP_001890145.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J80_RS15265 | 269230..269370 | - | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
K6J80_RS15270 | 269336..270271 | - | 936 | WP_000051985.1 | restriction endonuclease | - |
K6J80_RS15275 | 270552..271151 | - | 600 | WP_000429495.1 | DUF6338 family protein | - |
K6J80_RS15280 | 271306..271572 | - | 267 | WP_000937852.1 | hypothetical protein | - |
K6J80_RS15285 | 271786..272469 | - | 684 | WP_000877436.1 | hypothetical protein | - |
K6J80_RS15290 | 272893..272985 | - | 93 | WP_014164112.1 | DUF3265 domain-containing protein | - |
K6J80_RS15295 | 273007..273585 | - | 579 | WP_000110120.1 | hypothetical protein | - |
K6J80_RS15300 | 273814..274056 | + | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
K6J80_RS15305 | 274053..274352 | + | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K6J80_RS15310 | 274480..274875 | - | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
K6J80_RS15315 | 275089..275268 | - | 180 | WP_001883058.1 | DUF645 family protein | - |
K6J80_RS15320 | 275846..275935 | - | 90 | WP_072606010.1 | DUF3265 domain-containing protein | - |
K6J80_RS15325 | 275966..276664 | - | 699 | WP_001890502.1 | hypothetical protein | - |
K6J80_RS15330 | 276787..277413 | - | 627 | WP_000365424.1 | LysE family translocator | - |
K6J80_RS15335 | 277455..277547 | - | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
K6J80_RS15340 | 277562..278035 | - | 474 | WP_001161076.1 | GrpB family protein | - |
K6J80_RS15345 | 278235..278417 | - | 183 | WP_000923182.1 | DUF645 family protein | - |
K6J80_RS19050 | 278478..278615 | - | 138 | WP_001890145.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 213119..319686 | 106567 | |
inside | Integron | - | - | 213119..312856 | 99737 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T38679 WP_000802136.1 NZ_AP024554:274053-274352 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T38679 NZ_AP024554:274053-274352 [Vibrio cholerae]
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCAGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
ATGAAACCATTTAATCTTACCGTCGCCGCCAAAGCCGATTTACGTGATATTGCTTTATTCACTCAACGACGCTGGGGAAA
AGAGCAGCGAAATGTTTATTTAAAGCAATTCGATGATTCCTTTTGGCTTTTAGCGGAAAATCCCGACATTGGTAAATCAT
GCGATGAAATCCGAGAGGGATACAGAAAATTTCCCCAAGGGAGTCACGTCATCTTTTATCAGCAAACCGGCAGCCAACAA
ATCAGGGTGATCCGAATTCTTCATAAGAGCATGGATGTGAACCCAATATTCGGCGCATAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT38679 WP_001107719.1 NZ_AP024554:273814-274056 [Vibrio cholerae]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT38679 NZ_AP024554:273814-274056 [Vibrio cholerae]
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
ATGGCTAAAAATACAAGTATCACTCTTGGTGAACACTTCGATGGCTTTATTACAAGCCAAATACAAAGTGGGCGTTACGG
CTCAGCAAGTGAAGTCATTCGCTCTGCGCTACGTCTACTCGAAAACCAAGAAACCAAACTACAGTCACTCCGTCAACTAC
TTATTGAAGGAGAGCAAAGTGGTGACGCTGATTATGACCTTGATAGCTTCATCAATGAACTCGATAGTGAAAACATTCGA
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A | |
PDB | 7B22 | |
AlphaFold DB | A0A151JFU4 |