Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | dhiT-phd/- |
Location | 132686..133090 | Replicon | chromosome |
Accession | NZ_CP007635 | ||
Organism | Vibrio cholerae strain 2012EL-2176 |
Toxin (Protein)
Gene name | dhiT | Uniprot ID | A0A086SLD6 |
Locus tag | EN18_RS15050 | Protein ID | WP_001114075.1 |
Coordinates | 132821..133090 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | EN18_RS21240 | Protein ID | WP_099607150.1 |
Coordinates | 132686..132790 (+) | Length | 35 a.a. |
Genomic Context
Location: 128187..129104 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 129261..129650 (390 bp)
Type: Others
Protein ID: WP_001081302.1
Type: Others
Protein ID: WP_001081302.1
Location: 129786..129995 (210 bp)
Type: Others
Protein ID: Protein_203
Type: Others
Protein ID: Protein_203
Location: 130114..130551 (438 bp)
Type: Others
Protein ID: WP_000503169.1
Type: Others
Protein ID: WP_000503169.1
Location: 130615..130833 (219 bp)
Type: Others
Protein ID: WP_071908318.1
Type: Others
Protein ID: WP_071908318.1
Location: 131008..131880 (873 bp)
Type: Others
Protein ID: WP_000254716.1
Type: Others
Protein ID: WP_000254716.1
Location: 132030..132629 (600 bp)
Type: Others
Protein ID: WP_001891245.1
Type: Others
Protein ID: WP_001891245.1
Location: 132686..132790 (105 bp)
Type: Antitoxin
Protein ID: WP_099607150.1
Type: Antitoxin
Protein ID: WP_099607150.1
Location: 132821..133090 (270 bp)
Type: Toxin
Protein ID: WP_001114075.1
Type: Toxin
Protein ID: WP_001114075.1
Location: 133084..133605 (522 bp)
Type: Others
Protein ID: WP_000921691.1
Type: Others
Protein ID: WP_000921691.1
Location: 133904..134029 (126 bp)
Type: Others
Protein ID: WP_001905700.1
Type: Others
Protein ID: WP_001905700.1
Location: 134280..134675 (396 bp)
Type: Others
Protein ID: WP_001000867.1
Type: Others
Protein ID: WP_001000867.1
Location: 135567..136082 (516 bp)
Type: Others
Protein ID: WP_000343779.1
Type: Others
Protein ID: WP_000343779.1
Location: 136266..136679 (414 bp)
Type: Others
Protein ID: WP_000049420.1
Type: Others
Protein ID: WP_000049420.1
Location: 134814..135092 (279 bp)
Type: Others
Protein ID: WP_000578476.1
Type: Others
Protein ID: WP_000578476.1
Location: 135089..135373 (285 bp)
Type: Others
Protein ID: WP_000381183.1
Type: Others
Protein ID: WP_000381183.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EN18_RS15015 | 128187..129104 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
EN18_RS15020 | 129261..129650 | + | 390 | WP_001081302.1 | hypothetical protein | - |
EN18_RS15025 | 129786..129995 | + | 210 | Protein_203 | GNAT family N-acetyltransferase | - |
EN18_RS15030 | 130114..130551 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
EN18_RS15035 | 130615..130833 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
EN18_RS15040 | 131008..131880 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
EN18_RS15045 | 132030..132629 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
EN18_RS21240 | 132686..132790 | + | 105 | WP_099607150.1 | acetyltransferase | Antitoxin |
EN18_RS15050 | 132821..133090 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
EN18_RS15055 | 133084..133605 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | - |
EN18_RS21245 | 133904..134029 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
EN18_RS15060 | 134280..134675 | + | 396 | WP_001000867.1 | hypothetical protein | - |
EN18_RS15065 | 134814..135092 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
EN18_RS15070 | 135089..135373 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
EN18_RS15075 | 135567..136082 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
EN18_RS15080 | 136266..136679 | + | 414 | WP_000049420.1 | VOC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31037..137542 | 106505 | |
inside | Integron | - | - | 36117..137166 | 101049 | ||
flank | IS/Tn | - | - | 130114..130551 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T46764 WP_001114075.1 NZ_CP007635:132821-133090 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
>T46764 NZ_CP007635:132821-133090 [Vibrio cholerae]
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
ATGCCAGAGATTGATGCCCTATTAGGTCTTTCATTTTGCTTGTACTTCTTTGATAACAAGCAGCATAAATTACCTCATAT
TCACGTTAAGTACGGTAGTTACGAGCTAATTATTGCTATTGAAACAGGTGAGTGTTTAGAGGGTTACTTACCCAATAAGC
AACGAAAACGTGCTGAAAACCATATTCTTGAACATCGAGAGCAATTGATGGTGATGTGGAATAAAGCGGTGAATGGTGAA
AATCCAGGTAAGTTAGGTGATTTATGTTGA
Antitoxin
Download Length: 35 a.a. Molecular weight: 3991.79 Da Isoelectric Point: 9.2853
>AT46764 WP_099607150.1 NZ_CP007635:132686-132790 [Vibrio cholerae]
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
VVSVVVFEFSSMRCQPLRRALYAYRNCLLKDTLL
Download Length: 105 bp
>AT46764 NZ_CP007635:132686-132790 [Vibrio cholerae]
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
GTGGTTTCGGTTGTTGTGTTTGAGTTTAGTAGTATGCGCTGCCAGCCCCTTAGGCGGGCGTTATATGCTTATAGGAATTG
TCTCCTAAAGGATACGCTGCTATAG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086SLD6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |