Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 758749..759287 | Replicon | chromosome |
Accession | NZ_CP102928 | ||
Organism | Vibrio cholerae strain N1252 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | NW313_RS17405 | Protein ID | WP_000802136.1 |
Coordinates | 758749..759048 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | NW313_RS17410 | Protein ID | WP_001107719.1 |
Coordinates | 759045..759287 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW313_RS17360 | 754486..754623 | + | 138 | WP_001890145.1 | hypothetical protein | - |
NW313_RS17365 | 754684..754866 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
NW313_RS17370 | 755066..755539 | + | 474 | WP_001161076.1 | GrpB family protein | - |
NW313_RS17375 | 755554..755646 | + | 93 | WP_014378730.1 | DUF3265 domain-containing protein | - |
NW313_RS17380 | 755688..756314 | + | 627 | WP_000365424.1 | LysE family translocator | - |
NW313_RS17385 | 756437..757135 | + | 699 | WP_001890502.1 | hypothetical protein | - |
NW313_RS17390 | 757166..757255 | + | 90 | WP_072606010.1 | DUF3265 domain-containing protein | - |
NW313_RS17395 | 757833..758012 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
NW313_RS17400 | 758226..758621 | + | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
NW313_RS17405 | 758749..759048 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NW313_RS17410 | 759045..759287 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
NW313_RS17415 | 759516..760094 | + | 579 | WP_000110120.1 | hypothetical protein | - |
NW313_RS17420 | 760116..760208 | + | 93 | WP_014164112.1 | DUF3265 domain-containing protein | - |
NW313_RS17425 | 760632..761315 | + | 684 | WP_000877436.1 | hypothetical protein | - |
NW313_RS17430 | 761529..761795 | + | 267 | WP_000937852.1 | hypothetical protein | - |
NW313_RS17435 | 761950..762549 | + | 600 | WP_000429495.1 | DUF6338 family protein | - |
NW313_RS17440 | 762830..763765 | + | 936 | WP_000051985.1 | restriction endonuclease | - |
NW313_RS17445 | 763731..763871 | + | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 713852..820357 | 106505 | |
inside | Integron | catB9 | - | 718932..819981 | 101049 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T254470 WP_000802136.1 NZ_CP102928:c759048-758749 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|