Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 398051..398629 | Replicon | chromosome |
Accession | NZ_CP013314 | ||
Organism | Vibrio cholerae strain E9120 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | ASZ79_RS16360 | Protein ID | WP_001180243.1 |
Coordinates | 398051..398368 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | ASZ79_RS16365 | Protein ID | WP_000557292.1 |
Coordinates | 398387..398629 (-) | Length | 81 a.a. |
Genomic Context
Location: 393242..393637 (396 bp)
Type: Others
Protein ID: WP_000046952.1
Type: Others
Protein ID: WP_000046952.1
Location: 393940..394121 (182 bp)
Type: Others
Protein ID: Protein_402
Type: Others
Protein ID: Protein_402
Location: 394298..394693 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 394837..395373 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 395670..395849 (180 bp)
Type: Others
Protein ID: WP_001883039.1
Type: Others
Protein ID: WP_001883039.1
Location: 396045..396470 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 396619..396966 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 397113..397406 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 397762..397857 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 398871..399380 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 399437..400090 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 400400..400618 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 401021..401254 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 401679..401859 (181 bp)
Type: Others
Protein ID: Protein_416
Type: Others
Protein ID: Protein_416
Location: 402126..402413 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 402424..402741 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 402738..402848 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 403025..403150 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 403166..403204 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 398051..398368 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 398387..398629 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ79_RS16310 | 393242..393637 | + | 396 | WP_000046952.1 | hypothetical protein | - |
ASZ79_RS16315 | 393940..394121 | + | 182 | Protein_402 | DUF645 family protein | - |
ASZ79_RS16320 | 394298..394693 | + | 396 | WP_000046953.1 | hypothetical protein | - |
ASZ79_RS16325 | 394837..395373 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
ASZ79_RS16330 | 395670..395849 | + | 180 | WP_001883039.1 | DUF645 family protein | - |
ASZ79_RS16335 | 396045..396470 | + | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
ASZ79_RS16340 | 396619..396966 | + | 348 | WP_000933409.1 | hypothetical protein | - |
ASZ79_RS20640 | 397113..397406 | + | 294 | WP_125460920.1 | hypothetical protein | - |
ASZ79_RS21005 | 397762..397857 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
ASZ79_RS16360 | 398051..398368 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ79_RS16365 | 398387..398629 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ASZ79_RS16370 | 398871..399380 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
ASZ79_RS16375 | 399437..400090 | + | 654 | WP_000226874.1 | hypothetical protein | - |
ASZ79_RS16380 | 400400..400618 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
ASZ79_RS16390 | 401021..401254 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
ASZ79_RS16395 | 401679..401859 | + | 181 | Protein_416 | DUF645 family protein | - |
ASZ79_RS16400 | 402126..402413 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ASZ79_RS16405 | 402424..402741 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
ASZ79_RS21010 | 402738..402848 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
ASZ79_RS21015 | 403025..403150 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
ASZ79_RS21020 | 403166..403204 | + | 39 | WP_106019119.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304700..468464 | 163764 | |
inside | Integron | - | - | 309780..468088 | 158308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T58359 WP_001180243.1 NZ_CP013314:c398368-398051 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T58359 NZ_CP013314:c398368-398051 [Vibrio cholerae]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT58359 WP_000557292.1 NZ_CP013314:c398629-398387 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT58359 NZ_CP013314:c398629-398387 [Vibrio cholerae]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |