295400

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-Phd
Location 446274..446821 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name relE Uniprot ID Q9KM92
Locus tag OC617_RS16310 Protein ID WP_000229317.1
Coordinates 446519..446821 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KM93
Locus tag OC617_RS16305 Protein ID WP_000861987.1
Coordinates 446274..446531 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS16240 (CNRVC190243H_03183) 441303..441758 + 456 WP_001245327.1 GNAT family N-acetyltransferase -
OC617_RS16245 441815..441937 + 123 Protein_471 acetyltransferase -
OC617_RS16250 442108..442232 + 125 Protein_472 DUF645 family protein -
OC617_RS16255 442349..442417 + 69 Protein_473 acetyltransferase -
OC617_RS16260 (CNRVC190243H_03184) 442434..442931 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
OC617_RS16265 (CNRVC190243H_03185) 442928..443200 - 273 WP_000246253.1 DUF1778 domain-containing protein -
OC617_RS16270 443352..443414 + 63 Protein_476 acetyltransferase -
OC617_RS16275 (CNRVC190243H_03186) 443431..444099 + 669 WP_000043871.1 hypothetical protein -
OC617_RS16280 (CNRVC190243H_03187) 444251..444538 + 288 WP_000426470.1 hypothetical protein -
OC617_RS16285 (CNRVC190243H_03188) 444679..445050 + 372 WP_001164080.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
OC617_RS16290 (CNRVC190243H_03189) 445273..445542 + 270 WP_000179600.1 DUF1778 domain-containing protein -
OC617_RS16295 (CNRVC190243H_03190) 445539..446072 + 534 WP_000118351.1 GNAT family N-acetyltransferase -
OC617_RS16300 446082..446192 + 111 WP_086010065.1 DUF3265 domain-containing protein -
OC617_RS16305 (CNRVC190243H_03191) 446274..446531 + 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OC617_RS16310 (CNRVC190243H_03192) 446519..446821 + 303 WP_000229317.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OC617_RS16315 (CNRVC190243H_03193) 447055..447972 + 918 WP_000186333.1 alpha/beta hydrolase -
OC617_RS16320 (CNRVC190243H_03194) 448129..448518 + 390 WP_001081302.1 hypothetical protein -
OC617_RS16325 (CNRVC190243H_03195) 448654..448863 + 210 Protein_487 GNAT family N-acetyltransferase -
OC617_RS16330 (CNRVC190243H_03196) 448982..449419 + 438 WP_000503169.1 IS200/IS605-like element IS1004 family transposase -
OC617_RS16335 (CNRVC190243H_03197) 449480..449701 + 222 Protein_489 GNAT family N-acetyltransferase -
OC617_RS16340 (CNRVC190243H_03198) 449876..450748 + 873 WP_000254716.1 DUF3800 domain-containing protein -
OC617_RS16345 (CNRVC190243H_03199) 450898..451497 + 600 WP_001891245.1 glutathione S-transferase N-terminal domain-containing protein -
OC617_RS16350 451554..451622 + 69 Protein_492 acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049
flank IS/Tn - - 448982..449419 437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11726.68 Da        Isoelectric Point: 5.1972

>T295400 WP_000229317.1 NZ_OW443148:446519-446821 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9647.15 Da        Isoelectric Point: 7.3178

>AT295400 WP_000861987.1 NZ_OW443148:446274-446531 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q9KM92

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SLM9

References