Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-Phd |
| Location | 446274..446821 | Replicon | chromosome |
| Accession | NZ_OW443148 | ||
| Organism | Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q9KM92 |
| Locus tag | OC617_RS16310 | Protein ID | WP_000229317.1 |
| Coordinates | 446519..446821 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9KM93 |
| Locus tag | OC617_RS16305 | Protein ID | WP_000861987.1 |
| Coordinates | 446274..446531 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OC617_RS16240 (CNRVC190243H_03183) | 441303..441758 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
| OC617_RS16245 | 441815..441937 | + | 123 | Protein_471 | acetyltransferase | - |
| OC617_RS16250 | 442108..442232 | + | 125 | Protein_472 | DUF645 family protein | - |
| OC617_RS16255 | 442349..442417 | + | 69 | Protein_473 | acetyltransferase | - |
| OC617_RS16260 (CNRVC190243H_03184) | 442434..442931 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
| OC617_RS16265 (CNRVC190243H_03185) | 442928..443200 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
| OC617_RS16270 | 443352..443414 | + | 63 | Protein_476 | acetyltransferase | - |
| OC617_RS16275 (CNRVC190243H_03186) | 443431..444099 | + | 669 | WP_000043871.1 | hypothetical protein | - |
| OC617_RS16280 (CNRVC190243H_03187) | 444251..444538 | + | 288 | WP_000426470.1 | hypothetical protein | - |
| OC617_RS16285 (CNRVC190243H_03188) | 444679..445050 | + | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
| OC617_RS16290 (CNRVC190243H_03189) | 445273..445542 | + | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
| OC617_RS16295 (CNRVC190243H_03190) | 445539..446072 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
| OC617_RS16300 | 446082..446192 | + | 111 | WP_086010065.1 | DUF3265 domain-containing protein | - |
| OC617_RS16305 (CNRVC190243H_03191) | 446274..446531 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OC617_RS16310 (CNRVC190243H_03192) | 446519..446821 | + | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OC617_RS16315 (CNRVC190243H_03193) | 447055..447972 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
| OC617_RS16320 (CNRVC190243H_03194) | 448129..448518 | + | 390 | WP_001081302.1 | hypothetical protein | - |
| OC617_RS16325 (CNRVC190243H_03195) | 448654..448863 | + | 210 | Protein_487 | GNAT family N-acetyltransferase | - |
| OC617_RS16330 (CNRVC190243H_03196) | 448982..449419 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
| OC617_RS16335 (CNRVC190243H_03197) | 449480..449701 | + | 222 | Protein_489 | GNAT family N-acetyltransferase | - |
| OC617_RS16340 (CNRVC190243H_03198) | 449876..450748 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
| OC617_RS16345 (CNRVC190243H_03199) | 450898..451497 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
| OC617_RS16350 | 451554..451622 | + | 69 | Protein_492 | acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 349905..456410 | 106505 | |
| inside | Integron | catB9 | - | 354985..456034 | 101049 | ||
| flank | IS/Tn | - | - | 448982..449419 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11726.68 Da Isoelectric Point: 5.1972
>T295400 WP_000229317.1 NZ_OW443148:446519-446821 [Vibrio cholerae]
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9KM92 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1T4SLM9 |