294353

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 910735..911501 Replicon chromosome
Accession NZ_LT992487
Organism Vibrio cholerae strain 4295STDY6534216

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag DG247_RS18460 Protein ID WP_000982260.1
Coordinates 911004..911501 (+) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag DG247_RS18455 Protein ID WP_000246253.1
Coordinates 910735..911007 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG247_RS18410 905963..906880 - 918 WP_000186333.1 alpha/beta hydrolase -
DG247_RS18415 907114..907416 - 303 WP_000229317.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG247_RS18420 907404..907661 - 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG247_RS18430 907863..908396 - 534 WP_000118351.1 GNAT family N-acetyltransferase -
DG247_RS18435 908393..908818 - 426 WP_001882332.1 DUF1778 domain-containing protein -
DG247_RS18440 908885..909256 - 372 WP_001164080.1 nucleotide pyrophosphohydrolase -
DG247_RS18445 909397..909684 - 288 WP_000426470.1 hypothetical protein -
DG247_RS18450 909836..910504 - 669 WP_000043871.1 hypothetical protein -
DG247_RS18455 910735..911007 + 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
DG247_RS18460 911004..911501 + 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
DG247_RS18470 911703..911855 - 153 WP_001884520.1 DUF645 family protein -
DG247_RS18475 912177..912632 - 456 WP_001245327.1 GNAT family N-acetyltransferase -
DG247_RS18480 912760..913047 - 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin -
DG247_RS18485 913037..913288 - 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DG247_RS18490 913502..913915 - 414 WP_000049417.1 VOC family protein -
DG247_RS18495 913990..914133 - 144 WP_071908341.1 DUF3265 domain-containing protein -
DG247_RS18500 914103..914504 - 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin -
DG247_RS18505 914504..915196 - 693 WP_001047169.1 GNAT family N-acetyltransferase -
DG247_RS18510 915333..915639 - 307 Protein_787 CatB-related O-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 897525..994497 96972
inside Integron catB9 - 897901..987709 89808
flank IS/Tn - - 915707..916687 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T294353 WP_000982260.1 NZ_LT992487:911004-911501 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT294353 WP_000246253.1 NZ_LT992487:910735-911007 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References