Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /GNAT-DUF1778 |
| Location | 910735..911501 | Replicon | chromosome |
| Accession | NZ_LT992487 | ||
| Organism | Vibrio cholerae strain 4295STDY6534216 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | Q9K2P7 |
| Locus tag | DG247_RS18460 | Protein ID | WP_000982260.1 |
| Coordinates | 911004..911501 (+) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | Q9K2J6 |
| Locus tag | DG247_RS18455 | Protein ID | WP_000246253.1 |
| Coordinates | 910735..911007 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG247_RS18410 | 905963..906880 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
| DG247_RS18415 | 907114..907416 | - | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DG247_RS18420 | 907404..907661 | - | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| DG247_RS18430 | 907863..908396 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
| DG247_RS18435 | 908393..908818 | - | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
| DG247_RS18440 | 908885..909256 | - | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
| DG247_RS18445 | 909397..909684 | - | 288 | WP_000426470.1 | hypothetical protein | - |
| DG247_RS18450 | 909836..910504 | - | 669 | WP_000043871.1 | hypothetical protein | - |
| DG247_RS18455 | 910735..911007 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | Antitoxin |
| DG247_RS18460 | 911004..911501 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | Toxin |
| DG247_RS18470 | 911703..911855 | - | 153 | WP_001884520.1 | DUF645 family protein | - |
| DG247_RS18475 | 912177..912632 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
| DG247_RS18480 | 912760..913047 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DG247_RS18485 | 913037..913288 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| DG247_RS18490 | 913502..913915 | - | 414 | WP_000049417.1 | VOC family protein | - |
| DG247_RS18495 | 913990..914133 | - | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
| DG247_RS18500 | 914103..914504 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| DG247_RS18505 | 914504..915196 | - | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
| DG247_RS18510 | 915333..915639 | - | 307 | Protein_787 | CatB-related O-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 897525..994497 | 96972 | |
| inside | Integron | catB9 | - | 897901..987709 | 89808 | ||
| flank | IS/Tn | - | - | 915707..916687 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18527.18 Da Isoelectric Point: 8.7753
>T294353 WP_000982260.1 NZ_LT992487:911004-911501 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q0KGB1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 1Y9B | |
| AlphaFold DB | A0A0F2IC79 |