Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 910735..911501 | Replicon | chromosome |
Accession | NZ_LT992487 | ||
Organism | Vibrio cholerae strain 4295STDY6534216 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q9K2P7 |
Locus tag | DG247_RS18460 | Protein ID | WP_000982260.1 |
Coordinates | 911004..911501 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | Q9K2J6 |
Locus tag | DG247_RS18455 | Protein ID | WP_000246253.1 |
Coordinates | 910735..911007 (+) | Length | 91 a.a. |
Genomic Context
Location: 910735..911007 (273 bp)
Type: Antitoxin
Protein ID: WP_000246253.1
Type: Antitoxin
Protein ID: WP_000246253.1
Location: 911004..911501 (498 bp)
Type: Toxin
Protein ID: WP_000982260.1
Type: Toxin
Protein ID: WP_000982260.1
Location: 905963..906880 (918 bp)
Type: Others
Protein ID: WP_000186333.1
Type: Others
Protein ID: WP_000186333.1
Location: 907114..907416 (303 bp)
Type: Others
Protein ID: WP_000229317.1
Type: Others
Protein ID: WP_000229317.1
Location: 907404..907661 (258 bp)
Type: Others
Protein ID: WP_000861987.1
Type: Others
Protein ID: WP_000861987.1
Location: 907863..908396 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 908393..908818 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 908885..909256 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 909397..909684 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 909836..910504 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 911703..911855 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 912177..912632 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 912760..913047 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 913037..913288 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 913502..913915 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 913990..914133 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 914103..914504 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 914504..915196 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 915333..915639 (307 bp)
Type: Others
Protein ID: Protein_787
Type: Others
Protein ID: Protein_787
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG247_RS18410 | 905963..906880 | - | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
DG247_RS18415 | 907114..907416 | - | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
DG247_RS18420 | 907404..907661 | - | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
DG247_RS18430 | 907863..908396 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
DG247_RS18435 | 908393..908818 | - | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
DG247_RS18440 | 908885..909256 | - | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
DG247_RS18445 | 909397..909684 | - | 288 | WP_000426470.1 | hypothetical protein | - |
DG247_RS18450 | 909836..910504 | - | 669 | WP_000043871.1 | hypothetical protein | - |
DG247_RS18455 | 910735..911007 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | Antitoxin |
DG247_RS18460 | 911004..911501 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | Toxin |
DG247_RS18470 | 911703..911855 | - | 153 | WP_001884520.1 | DUF645 family protein | - |
DG247_RS18475 | 912177..912632 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
DG247_RS18480 | 912760..913047 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
DG247_RS18485 | 913037..913288 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
DG247_RS18490 | 913502..913915 | - | 414 | WP_000049417.1 | VOC family protein | - |
DG247_RS18495 | 913990..914133 | - | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
DG247_RS18500 | 914103..914504 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
DG247_RS18505 | 914504..915196 | - | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
DG247_RS18510 | 915333..915639 | - | 307 | Protein_787 | CatB-related O-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 897525..994497 | 96972 | |
inside | Integron | catB9 | - | 897901..987709 | 89808 | ||
flank | IS/Tn | - | - | 915707..916687 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18527.18 Da Isoelectric Point: 8.7753
>T294353 WP_000982260.1 NZ_LT992487:911004-911501 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG
Download Length: 498 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0KGB1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 1Y9B | |
AlphaFold DB | A0A0F2IC79 |