295388

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 373190..373730 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name relE Uniprot ID A0A151JGK8
Locus tag OC617_RS15535 Protein ID WP_000277238.1
Coordinates 373190..373459 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KML3
Locus tag OC617_RS15540 Protein ID WP_001258569.1
Coordinates 373452..373730 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS15495 (CNRVC190243H_03086) 368411..368947 + 537 WP_000469482.1 GNAT family protein -
OC617_RS15500 (CNRVC190243H_03087) 369138..369599 + 462 WP_001903091.1 lipocalin family protein -
OC617_RS15505 369664..369732 + 69 Protein_323 acetyltransferase -
OC617_RS15510 (CNRVC190243H_03088) 369749..370246 - 498 WP_000982260.1 GNAT family N-acetyltransferase -
OC617_RS15515 (CNRVC190243H_03089) 370243..370515 - 273 WP_000246253.1 DUF1778 domain-containing protein -
OC617_RS15520 370908..371033 + 126 WP_001900195.1 DUF645 family protein -
OC617_RS15525 (CNRVC190243H_03090) 371283..371729 + 447 WP_000006157.1 hypothetical protein -
OC617_RS15530 (CNRVC190243H_03091) 371792..373003 + 1212 WP_001122813.1 IS256 family transposase -
OC617_RS15535 (CNRVC190243H_03092) 373190..373459 - 270 WP_000277238.1 type II toxin-antitoxin system YafQ family toxin Toxin
OC617_RS15540 (CNRVC190243H_03093) 373452..373730 - 279 WP_001258569.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OC617_RS15545 373781..373898 + 118 Protein_331 DUF3265 domain-containing protein -
OC617_RS15550 374016..374294 + 279 WP_001921601.1 DUF3709 domain-containing protein -
OC617_RS15555 374654..374752 + 99 WP_223225486.1 DUF3709 domain-containing protein -
OC617_RS15560 374952..375053 + 102 WP_001921603.1 hypothetical protein -
OC617_RS15565 (CNRVC190243H_03094) 375043..375429 + 387 WP_000703163.1 VOC family protein -
OC617_RS15570 (CNRVC190243H_03095) 375624..375875 + 252 WP_001890111.1 TIGR03643 family protein -
OC617_RS15575 375848..375997 + 150 WP_071908333.1 DUF3265 domain-containing protein -
OC617_RS15580 (CNRVC190243H_03096) 376089..376331 + 243 WP_000107461.1 hypothetical protein -
OC617_RS15585 376583..376861 + 279 WP_000280324.1 DUF3709 domain-containing protein -
OC617_RS15590 377293..377336 + 44 Protein_340 hypothetical protein -
OC617_RS15595 377318..377411 + 94 Protein_341 ggdef family protein -
OC617_RS15600 377380..377511 + 132 WP_001883067.1 hypothetical protein -
OC617_RS15605 (CNRVC190243H_03097) 377683..378150 + 468 WP_001289288.1 OsmC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049
- flank IS/Tn - - 371792..373003 1211


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-85)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10406.11 Da        Isoelectric Point: 9.5084

>T295388 WP_000277238.1 NZ_OW443148:c373459-373190 [Vibrio cholerae]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF

Download         Length: 270 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10088.58 Da        Isoelectric Point: 6.0728

>AT295388 WP_001258569.1 NZ_OW443148:c373730-373452 [Vibrio cholerae]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A151JGK8

Antitoxin

Source ID Structure
AlphaFold DB A0A151KTP9

References