295394

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 419942..420470 Replicon chromosome
Accession NZ_OW443148
Organism Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI

Toxin (Protein)


Gene name relE Uniprot ID H9L4R3
Locus tag OC617_RS16035 Protein ID WP_000221352.1
Coordinates 419942..420232 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID H9L4T4
Locus tag OC617_RS16040 Protein ID WP_000213183.1
Coordinates 420222..420470 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OC617_RS15985 415212..415322 + 111 WP_134814058.1 DUF3265 domain-containing protein -
OC617_RS15990 415361..415471 + 111 Protein_420 acetyltransferase -
OC617_RS15995 415499..415624 + 126 WP_001944767.1 DUF645 family protein -
OC617_RS16000 415587..415703 + 117 WP_001889170.1 hypothetical protein -
OC617_RS16005 (CNRVC190243H_03145) 415891..416895 + 1005 WP_000964925.1 LD-carboxypeptidase -
OC617_RS16010 (CNRVC190243H_03146) 417048..417494 + 447 WP_000128977.1 hypothetical protein -
OC617_RS16015 (CNRVC190243H_03147) 417614..418543 + 930 WP_000335802.1 hypothetical protein -
OC617_RS16020 418540..418650 + 111 WP_071917832.1 DUF3265 domain-containing protein -
OC617_RS16025 (CNRVC190243H_03148) 418678..419154 + 477 WP_001047180.1 GNAT family N-acetyltransferase -
OC617_RS16030 (CNRVC190243H_03149) 419345..419806 + 462 WP_001911752.1 lipocalin family protein -
OC617_RS16035 (CNRVC190243H_03150) 419942..420232 - 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OC617_RS16040 (CNRVC190243H_03151) 420222..420470 - 249 WP_000213183.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OC617_RS16045 (CNRVC190243H_03153) 421041..421694 + 654 WP_000036957.1 site-specific DNA-methyltransferase -
OC617_RS16050 (CNRVC190243H_03154) 421966..422391 + 426 WP_000415748.1 hypothetical protein -
OC617_RS16055 (CNRVC190243H_03155) 422599..422994 + 396 WP_000649527.1 DUF3465 domain-containing protein -
OC617_RS16060 (CNRVC190243H_03156) 423145..423675 + 531 WP_000415563.1 hypothetical protein -
OC617_RS16065 (CNRVC190243H_03157) 423813..424313 + 501 WP_000789723.1 hypothetical protein -
OC617_RS16070 (CNRVC190243H_03158) 424469..424867 + 399 WP_001882293.1 hypothetical protein -
OC617_RS16075 (CNRVC190243H_03159) 424967..425431 - 465 WP_000140244.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 349905..456410 106505
inside Integron catB9 - 354985..456034 101049


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11247.23 Da        Isoelectric Point: 10.4678

>T295394 WP_000221352.1 NZ_OW443148:c420232-419942 [Vibrio cholerae]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8937.28 Da        Isoelectric Point: 4.1079

>AT295394 WP_000213183.1 NZ_OW443148:c420470-420222 [Vibrio cholerae]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKERLSEDSVSVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H9L4R3

Antitoxin

Source ID Structure
AlphaFold DB A0A366A3W8

References