Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 353156..353694 | Replicon | chromosome |
Accession | NZ_CP047300 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain P27459 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | GTF71_RS15140 | Protein ID | WP_000802136.1 |
Coordinates | 353156..353455 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | GTF71_RS15145 | Protein ID | WP_001107719.1 |
Coordinates | 353452..353694 (-) | Length | 81 a.a. |
Genomic Context
Location: 349091..349273 (183 bp)
Type: Others
Protein ID: WP_000923182.1
Type: Others
Protein ID: WP_000923182.1
Location: 349473..349946 (474 bp)
Type: Others
Protein ID: WP_001161076.1
Type: Others
Protein ID: WP_001161076.1
Location: 349943..350053 (111 bp)
Type: Others
Protein ID: WP_071908312.1
Type: Others
Protein ID: WP_071908312.1
Location: 350095..350721 (627 bp)
Type: Others
Protein ID: WP_000365424.1
Type: Others
Protein ID: WP_000365424.1
Location: 350844..351542 (699 bp)
Type: Others
Protein ID: WP_001890502.1
Type: Others
Protein ID: WP_001890502.1
Location: 351546..351662 (117 bp)
Type: Others
Protein ID: WP_071908339.1
Type: Others
Protein ID: WP_071908339.1
Location: 352240..352419 (180 bp)
Type: Others
Protein ID: WP_001883058.1
Type: Others
Protein ID: WP_001883058.1
Location: 352633..353028 (396 bp)
Type: Others
Protein ID: WP_000870857.1
Type: Others
Protein ID: WP_000870857.1
Location: 353923..354501 (579 bp)
Type: Others
Protein ID: WP_000110120.1
Type: Others
Protein ID: WP_000110120.1
Location: 354505..354615 (111 bp)
Type: Others
Protein ID: WP_071908313.1
Type: Others
Protein ID: WP_071908313.1
Location: 355039..355722 (684 bp)
Type: Others
Protein ID: WP_000877436.1
Type: Others
Protein ID: WP_000877436.1
Location: 355936..356202 (267 bp)
Type: Others
Protein ID: WP_000937852.1
Type: Others
Protein ID: WP_000937852.1
Location: 356357..356956 (600 bp)
Type: Others
Protein ID: WP_000429495.1
Type: Others
Protein ID: WP_000429495.1
Location: 357237..358172 (936 bp)
Type: Others
Protein ID: WP_000051985.1
Type: Others
Protein ID: WP_000051985.1
Location: 358138..358278 (141 bp)
Type: Others
Protein ID: WP_001883049.1
Type: Others
Protein ID: WP_001883049.1
Location: 353156..353455 (300 bp)
Type: Toxin
Protein ID: WP_000802136.1
Type: Toxin
Protein ID: WP_000802136.1
Location: 353452..353694 (243 bp)
Type: Antitoxin
Protein ID: WP_001107719.1
Type: Antitoxin
Protein ID: WP_001107719.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTF71_RS15100 | 349091..349273 | + | 183 | WP_000923182.1 | DUF645 family protein | - |
GTF71_RS15105 | 349473..349946 | + | 474 | WP_001161076.1 | GrpB family protein | - |
GTF71_RS15110 | 349943..350053 | + | 111 | WP_071908312.1 | DUF3265 domain-containing protein | - |
GTF71_RS15115 | 350095..350721 | + | 627 | WP_000365424.1 | LysE family translocator | - |
GTF71_RS15120 | 350844..351542 | + | 699 | WP_001890502.1 | hypothetical protein | - |
GTF71_RS15125 | 351546..351662 | + | 117 | WP_071908339.1 | DUF3265 domain-containing protein | - |
GTF71_RS15130 | 352240..352419 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
GTF71_RS15135 | 352633..353028 | + | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
GTF71_RS15140 | 353156..353455 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTF71_RS15145 | 353452..353694 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
GTF71_RS15150 | 353923..354501 | + | 579 | WP_000110120.1 | hypothetical protein | - |
GTF71_RS15155 | 354505..354615 | + | 111 | WP_071908313.1 | DUF3265 domain-containing protein | - |
GTF71_RS15160 | 355039..355722 | + | 684 | WP_000877436.1 | hypothetical protein | - |
GTF71_RS15165 | 355936..356202 | + | 267 | WP_000937852.1 | hypothetical protein | - |
GTF71_RS15170 | 356357..356956 | + | 600 | WP_000429495.1 | hypothetical protein | - |
GTF71_RS15175 | 357237..358172 | + | 936 | WP_000051985.1 | restriction endonuclease | - |
GTF71_RS15180 | 358138..358278 | + | 141 | WP_001883049.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 306926..439292 | 132366 | |
inside | Integron | - | - | 312006..438916 | 126910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T145848 WP_000802136.1 NZ_CP047300:c353455-353156 [Vibrio cholerae O1 biovar El Tor]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T145848 NZ_CP062702:3475962-3476249 [Escherichia coli O157:H7]
ATGTTACCCATTTTATGGCTACCGTCTGCTCGCGATGATTTGCGCCAGATCATAACTTACATCGCCAAGGAGAACCCACC
GGCAGCACGTAGACTAAAAATACGCATTGAAACATCGGTATTACCTCTATCTGAGCATCCGTACTTATATCCACCAAGCG
AACGGGTTTCTGGATTGAGAGAGATCGTGACCCACCCTAACTACATAATCCTGTACAGAGTAGCTGCTTCAAGCATTGAG
ATTGTAAGCGTGACACATTCTCGGCGACAATTTCCCTTCTCTATCTGA
ATGTTACCCATTTTATGGCTACCGTCTGCTCGCGATGATTTGCGCCAGATCATAACTTACATCGCCAAGGAGAACCCACC
GGCAGCACGTAGACTAAAAATACGCATTGAAACATCGGTATTACCTCTATCTGAGCATCCGTACTTATATCCACCAAGCG
AACGGGTTTCTGGATTGAGAGAGATCGTGACCCACCCTAACTACATAATCCTGTACAGAGTAGCTGCTTCAAGCATTGAG
ATTGTAAGCGTGACACATTCTCGGCGACAATTTCCCTTCTCTATCTGA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT145848 WP_001107719.1 NZ_CP047300:c353694-353452 [Vibrio cholerae O1 biovar El Tor]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT145848 NZ_CP062702:3475771-3475962 [Escherichia coli O157:H7]
ATGGGTACAGCCCTTTCTCCGATAGTTTCAGAATTCGAAACTACCGAACAAGAAAACAGTTACAACGAATGGTTGCGCAC
TAAAGTAACGTCAAGCCTTGCAGACACTCGCCCCGCAATTCCACATGACGAGGTAATGGCTGAAATGGAAAATCTTATTG
CTCAAATTGCTGTAACTAACAAGAGCGAGTAA
ATGGGTACAGCCCTTTCTCCGATAGTTTCAGAATTCGAAACTACCGAACAAGAAAACAGTTACAACGAATGGTTGCGCAC
TAAAGTAACGTCAAGCCTTGCAGACACTCGCCCCGCAATTCCACATGACGAGGTAATGGCTGAAATGGAAAATCTTATTG
CTCAAATTGCTGTAACTAACAAGAGCGAGTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 7R5A | |
PDB | 7B22 | |
AlphaFold DB | A0A151JFU4 |