Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 53014..53554 | Replicon | chromosome |
Accession | NZ_CP026648 | ||
Organism | Vibrio cholerae O1 biovar El Tor strain HC1037 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A151JGK8 |
Locus tag | C4E16_RS14450 | Protein ID | WP_000277238.1 |
Coordinates | 53014..53283 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KML3 |
Locus tag | C4E16_RS14455 | Protein ID | WP_001258569.1 |
Coordinates | 53276..53554 (-) | Length | 93 a.a. |
Genomic Context
Location: 48504..48890 (387 bp)
Type: Others
Protein ID: WP_001015867.1
Type: Others
Protein ID: WP_001015867.1
Location: 48947..49060 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 49009..49290 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 49548..50084 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 50221..50736 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 52045..52170 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 52186..52224 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 52420..52866 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 53840..54118 (279 bp)
Type: Others
Protein ID: WP_001921601.1
Type: Others
Protein ID: WP_001921601.1
Location: 54370..54576 (207 bp)
Type: Others
Protein ID: Protein_68
Type: Others
Protein ID: Protein_68
Location: 54776..54877 (102 bp)
Type: Others
Protein ID: WP_001921603.1
Type: Others
Protein ID: WP_001921603.1
Location: 54867..55253 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 55448..55699 (252 bp)
Type: Others
Protein ID: WP_001890111.1
Type: Others
Protein ID: WP_001890111.1
Location: 55672..55821 (150 bp)
Type: Others
Protein ID: WP_071908333.1
Type: Others
Protein ID: WP_071908333.1
Location: 55913..56155 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 56407..56685 (279 bp)
Type: Others
Protein ID: WP_000280324.1
Type: Others
Protein ID: WP_000280324.1
Location: 57060..57203 (144 bp)
Type: Others
Protein ID: Protein_75
Type: Others
Protein ID: Protein_75
Location: 57257..57295 (39 bp)
Type: Others
Protein ID: WP_082798268.1
Type: Others
Protein ID: WP_082798268.1
Location: 57507..57974 (468 bp)
Type: Others
Protein ID: WP_001289288.1
Type: Others
Protein ID: WP_001289288.1
Location: 48018..48260 (243 bp)
Type: Others
Protein ID: WP_000557292.1
Type: Others
Protein ID: WP_000557292.1
Location: 50886..51383 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 51380..51652 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 53014..53283 (270 bp)
Type: Toxin
Protein ID: WP_000277238.1
Type: Toxin
Protein ID: WP_000277238.1
Location: 53276..53554 (279 bp)
Type: Antitoxin
Protein ID: WP_001258569.1
Type: Antitoxin
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C4E16_RS14385 | 48018..48260 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
C4E16_RS14390 | 48504..48890 | + | 387 | WP_001015867.1 | NUDIX hydrolase | - |
C4E16_RS14395 | 48947..49060 | + | 114 | WP_001900214.1 | hypothetical protein | - |
C4E16_RS14400 | 49009..49290 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
C4E16_RS14415 | 49548..50084 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
C4E16_RS14420 | 50221..50736 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
C4E16_RS14425 | 50886..51383 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
C4E16_RS14430 | 51380..51652 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
C4E16_RS14435 | 52045..52170 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
C4E16_RS19415 | 52186..52224 | + | 39 | WP_106019118.1 | hypothetical protein | - |
C4E16_RS14445 | 52420..52866 | + | 447 | WP_000006157.1 | hypothetical protein | - |
C4E16_RS14450 | 53014..53283 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
C4E16_RS14455 | 53276..53554 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
C4E16_RS14465 | 53840..54118 | + | 279 | WP_001921601.1 | DUF3709 domain-containing protein | - |
C4E16_RS19420 | 54370..54576 | + | 207 | Protein_68 | DUF3709 domain-containing protein | - |
C4E16_RS14470 | 54776..54877 | + | 102 | WP_001921603.1 | hypothetical protein | - |
C4E16_RS14475 | 54867..55253 | + | 387 | WP_000703163.1 | VOC family protein | - |
C4E16_RS14480 | 55448..55699 | + | 252 | WP_001890111.1 | TIGR03643 family protein | - |
C4E16_RS14485 | 55672..55821 | + | 150 | WP_071908333.1 | DUF3265 domain-containing protein | - |
C4E16_RS14490 | 55913..56155 | + | 243 | WP_000107461.1 | hypothetical protein | - |
C4E16_RS14495 | 56407..56685 | + | 279 | WP_000280324.1 | DUF3709 domain-containing protein | - |
C4E16_RS19550 | 57060..57203 | + | 144 | Protein_75 | DUF645 family protein | - |
C4E16_RS19555 | 57257..57295 | + | 39 | WP_082798268.1 | hypothetical protein | - |
C4E16_RS14515 | 57507..57974 | + | 468 | WP_001289288.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 31043..136234 | 105191 | |
inside | Integron | - | - | 36123..135858 | 99735 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10406.11 Da Isoelectric Point: 9.5084
>T95377 WP_000277238.1 NZ_CP026648:c53283-53014 [Vibrio cholerae O1 biovar El Tor]
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
MYKLEYSTQFKKDFKKITKMPISDIIEVGNVISKLQRGEKLEPKNVDHPLTGNWVGFRDCHIKPDLVLIYRVFNDQLQLA
RIGSHSDLF
Download Length: 270 bp
>T95377 NZ_CP026648:c53283-53014 [Vibrio cholerae O1 biovar El Tor]
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
ATGTATAAACTCGAATACTCCACACAGTTTAAGAAAGATTTCAAAAAGATAACTAAGATGCCGATTTCAGACATCATTGA
AGTCGGCAATGTTATTTCTAAGCTGCAACGCGGCGAAAAGCTTGAACCCAAGAATGTTGACCATCCGTTAACTGGAAATT
GGGTTGGATTTCGAGACTGCCACATTAAACCCGACCTAGTGTTAATCTATCGAGTTTTTAACGATCAACTACAACTAGCG
CGCATTGGTTCACATAGTGATTTATTCTAA
Antitoxin
Download Length: 93 a.a. Molecular weight: 10088.58 Da Isoelectric Point: 6.0728
>AT95377 WP_001258569.1 NZ_CP026648:c53554-53276 [Vibrio cholerae O1 biovar El Tor]
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
MRTEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKAVINHGGIPFELRVPQPNEVTASAIQELVEGKGHKAESVEAM
LNELTEGKVKHV
Download Length: 279 bp
>AT95377 NZ_CP026648:c53554-53276 [Vibrio cholerae O1 biovar El Tor]
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
ATGAGAACAGAAATGCTGAGCACGCGCATTGACCACGACACGAAAATTGCGTTCACAAACGTCTGCGATGAGATGGGTCT
AAGTACATCACAGGCCATAAAGTTATTTGCAAAAGCGGTTATTAATCATGGTGGAATCCCTTTTGAGCTGCGAGTTCCAC
AGCCTAATGAGGTTACTGCATCTGCAATTCAAGAGCTCGTTGAAGGAAAAGGACATAAAGCTGAATCCGTTGAAGCTATG
CTGAATGAGCTTACTGAAGGCAAAGTTAAGCATGTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JGK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KTP9 |