294421

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) DhiAT/-
Location 288311..289095 Replicon chromosome
Accession NZ_LT992493
Organism Vibrio cholerae strain 4295STDY6534248

Toxin (Protein)


Gene name dhiT Uniprot ID A0A086SLD6
Locus tag DG169_RS16210 Protein ID WP_001114075.1
Coordinates 288311..288580 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name dhiA Uniprot ID Q9KM84
Locus tag DG169_RS16215 Protein ID WP_000921691.1
Coordinates 288574..289095 (+) Length 174 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DG169_RS16170 283677..284594 + 918 WP_000186333.1 alpha/beta hydrolase -
DG169_RS16175 284751..285140 + 390 WP_001081302.1 hypothetical protein -
DG169_RS16180 285276..285485 + 210 Protein_325 GNAT family N-acetyltransferase -
DG169_RS16185 285604..286041 + 438 WP_000503169.1 IS200/IS605-like element IS1004 family transposase -
DG169_RS16190 286105..286323 + 219 WP_071908318.1 GNAT family N-acetyltransferase -
DG169_RS16195 286498..287370 + 873 WP_000254716.1 DUF3800 domain-containing protein -
DG169_RS16200 287520..288119 + 600 WP_001891245.1 glutathione S-transferase N-terminal domain-containing protein -
DG169_RS16205 288176..288280 + 105 WP_099607150.1 acetyltransferase -
DG169_RS16210 288311..288580 + 270 WP_001114075.1 DUF4160 domain-containing protein Toxin
DG169_RS16215 288574..289095 + 522 WP_000921691.1 DUF2442 domain-containing protein Antitoxin
DG169_RS16220 289394..289519 + 126 WP_001905700.1 DUF645 family protein -
DG169_RS16230 289770..290165 + 396 WP_001000867.1 hypothetical protein -
DG169_RS16235 290304..290582 - 279 WP_000578476.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
DG169_RS16240 290579..290863 - 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
DG169_RS16245 291057..291572 + 516 WP_000343779.1 GNAT family N-acetyltransferase -
DG169_RS16255 291756..292169 + 414 WP_000049420.1 VOC family protein -
DG169_RS16270 292724..293901 + 1178 WP_086010879.1 IS3-like element ISVch4 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB9 - 197768..293032 95264
inside Integron catB9 - 202848..292656 89808
flank IS/Tn - - 285604..286041 437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF4160

(9-74)

Antitoxin

Protein of unknown function DUF2442

(4-59)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10310.94 Da        Isoelectric Point: 6.6303

>T294421 WP_001114075.1 NZ_LT992493:288311-288580 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC

Download         Length: 270 bp

Antitoxin


Download         Length: 174 a.a.        Molecular weight: 19409.01 Da        Isoelectric Point: 6.7342

>AT294421 WP_000921691.1 NZ_LT992493:288574-289095 [Vibrio cholerae]
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI

Download         Length: 522 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A086SLD6

Antitoxin

Source ID Structure
AlphaFold DB Q9KM84

References