Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DhiAT/- |
| Location | 288311..289095 | Replicon | chromosome |
| Accession | NZ_LT992493 | ||
| Organism | Vibrio cholerae strain 4295STDY6534248 | ||
Toxin (Protein)
| Gene name | dhiT | Uniprot ID | A0A086SLD6 |
| Locus tag | DG169_RS16210 | Protein ID | WP_001114075.1 |
| Coordinates | 288311..288580 (+) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | dhiA | Uniprot ID | Q9KM84 |
| Locus tag | DG169_RS16215 | Protein ID | WP_000921691.1 |
| Coordinates | 288574..289095 (+) | Length | 174 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG169_RS16170 | 283677..284594 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
| DG169_RS16175 | 284751..285140 | + | 390 | WP_001081302.1 | hypothetical protein | - |
| DG169_RS16180 | 285276..285485 | + | 210 | Protein_325 | GNAT family N-acetyltransferase | - |
| DG169_RS16185 | 285604..286041 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
| DG169_RS16190 | 286105..286323 | + | 219 | WP_071908318.1 | GNAT family N-acetyltransferase | - |
| DG169_RS16195 | 286498..287370 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
| DG169_RS16200 | 287520..288119 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
| DG169_RS16205 | 288176..288280 | + | 105 | WP_099607150.1 | acetyltransferase | - |
| DG169_RS16210 | 288311..288580 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
| DG169_RS16215 | 288574..289095 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | Antitoxin |
| DG169_RS16220 | 289394..289519 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
| DG169_RS16230 | 289770..290165 | + | 396 | WP_001000867.1 | hypothetical protein | - |
| DG169_RS16235 | 290304..290582 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
| DG169_RS16240 | 290579..290863 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| DG169_RS16245 | 291057..291572 | + | 516 | WP_000343779.1 | GNAT family N-acetyltransferase | - |
| DG169_RS16255 | 291756..292169 | + | 414 | WP_000049420.1 | VOC family protein | - |
| DG169_RS16270 | 292724..293901 | + | 1178 | WP_086010879.1 | IS3-like element ISVch4 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 197768..293032 | 95264 | |
| inside | Integron | catB9 | - | 202848..292656 | 89808 | ||
| flank | IS/Tn | - | - | 285604..286041 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T294421 WP_001114075.1 NZ_LT992493:288311-288580 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
Antitoxin
Download Length: 174 a.a. Molecular weight: 19409.01 Da Isoelectric Point: 6.7342
>AT294421 WP_000921691.1 NZ_LT992493:288574-289095 [Vibrio cholerae]
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
Download Length: 522 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086SLD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9KM84 |