Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DhiAT/- |
| Location | 451689..452473 | Replicon | chromosome |
| Accession | NZ_OW443148 | ||
| Organism | Vibrio cholerae strain CNRVC190243 isolate YE-NCPHL-19014-PI | ||
Toxin (Protein)
| Gene name | dhiT | Uniprot ID | A0A086SLD6 |
| Locus tag | OC617_RS16355 | Protein ID | WP_001114075.1 |
| Coordinates | 451689..451958 (+) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | dhiA | Uniprot ID | Q9KM84 |
| Locus tag | OC617_RS16360 | Protein ID | WP_000921691.1 |
| Coordinates | 451952..452473 (+) | Length | 174 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OC617_RS16315 (CNRVC190243H_03193) | 447055..447972 | + | 918 | WP_000186333.1 | alpha/beta hydrolase | - |
| OC617_RS16320 (CNRVC190243H_03194) | 448129..448518 | + | 390 | WP_001081302.1 | hypothetical protein | - |
| OC617_RS16325 (CNRVC190243H_03195) | 448654..448863 | + | 210 | Protein_487 | GNAT family N-acetyltransferase | - |
| OC617_RS16330 (CNRVC190243H_03196) | 448982..449419 | + | 438 | WP_000503169.1 | IS200/IS605-like element IS1004 family transposase | - |
| OC617_RS16335 (CNRVC190243H_03197) | 449480..449701 | + | 222 | Protein_489 | GNAT family N-acetyltransferase | - |
| OC617_RS16340 (CNRVC190243H_03198) | 449876..450748 | + | 873 | WP_000254716.1 | DUF3800 domain-containing protein | - |
| OC617_RS16345 (CNRVC190243H_03199) | 450898..451497 | + | 600 | WP_001891245.1 | glutathione S-transferase N-terminal domain-containing protein | - |
| OC617_RS16350 | 451554..451622 | + | 69 | Protein_492 | acetyltransferase | - |
| OC617_RS16355 (CNRVC190243H_03200) | 451689..451958 | + | 270 | WP_001114075.1 | DUF4160 domain-containing protein | Toxin |
| OC617_RS16360 (CNRVC190243H_03201) | 451952..452473 | + | 522 | WP_000921691.1 | DUF2442 domain-containing protein | Antitoxin |
| OC617_RS16365 | 452772..452897 | + | 126 | WP_001905700.1 | DUF645 family protein | - |
| OC617_RS16370 (CNRVC190243H_03202) | 453148..453543 | + | 396 | WP_001000867.1 | hypothetical protein | - |
| OC617_RS16375 (CNRVC190243H_03203) | 453682..453960 | - | 279 | WP_000578476.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
| OC617_RS16380 (CNRVC190243H_03204) | 453957..454241 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| OC617_RS16385 (CNRVC190243H_03205) | 454435..454950 | + | 516 | WP_000343779.1 | GNAT family protein | - |
| OC617_RS16390 (CNRVC190243H_03206) | 455134..455547 | + | 414 | WP_000049420.1 | VOC family protein | - |
| OC617_RS16395 | 456102..457279 | + | 1178 | WP_086010879.1 | IS3-like element ISVch4 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | catB9 | - | 349905..456410 | 106505 | |
| inside | Integron | catB9 | - | 354985..456034 | 101049 | ||
| flank | IS/Tn | - | - | 448982..449419 | 437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10310.94 Da Isoelectric Point: 6.6303
>T295401 WP_001114075.1 NZ_OW443148:451689-451958 [Vibrio cholerae]
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
MPEIDALLGLSFCLYFFDNKQHKLPHIHVKYGSYELIIAIETGECLEGYLPNKQRKRAENHILEHREQLMVMWNKAVNGE
NPGKLGDLC
Download Length: 270 bp
Antitoxin
Download Length: 174 a.a. Molecular weight: 19409.01 Da Isoelectric Point: 6.7342
>AT295401 WP_000921691.1 NZ_OW443148:451952-452473 [Vibrio cholerae]
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
MLKVIDVDFVSDHTLELTFNDGYQGYADLSVYFKKAPFSEIKDFKRFSLTRDGSLNWDGNELTAATLRDITKGSQKSVEL
SFNVQEMEAVIKQASWESMMEGRPDILQAAIRSYVEQFGHGQVIAKAGIKSRTSAYRSLKPETTPNFGTLVQLGHAVIEL
AKDRTVANKEPRI
Download Length: 522 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086SLD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9KM84 |