Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 378243..378790 | Replicon | chromosome |
Accession | NZ_CP013318 | ||
Organism | Vibrio cholerae strain NCTC5395 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C3LV30 |
Locus tag | ASZ85_RS16025 | Protein ID | WP_000229318.1 |
Coordinates | 378488..378790 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | ASZ85_RS16020 | Protein ID | WP_000861987.1 |
Coordinates | 378243..378500 (+) | Length | 86 a.a. |
Genomic Context
Location: 373386..373499 (114 bp)
Type: Others
Protein ID: WP_001900214.1
Type: Others
Protein ID: WP_001900214.1
Location: 373448..373729 (282 bp)
Type: Others
Protein ID: WP_001894429.1
Type: Others
Protein ID: WP_001894429.1
Location: 373987..374523 (537 bp)
Type: Others
Protein ID: WP_000469482.1
Type: Others
Protein ID: WP_000469482.1
Location: 374660..375175 (516 bp)
Type: Others
Protein ID: WP_001201509.1
Type: Others
Protein ID: WP_001201509.1
Location: 376484..376609 (126 bp)
Type: Others
Protein ID: WP_001900195.1
Type: Others
Protein ID: WP_001900195.1
Location: 376625..376663 (39 bp)
Type: Others
Protein ID: WP_106019118.1
Type: Others
Protein ID: WP_106019118.1
Location: 376859..377305 (447 bp)
Type: Others
Protein ID: WP_000006157.1
Type: Others
Protein ID: WP_000006157.1
Location: 378243..378500 (258 bp)
Type: Antitoxin
Protein ID: WP_000861987.1
Type: Antitoxin
Protein ID: WP_000861987.1
Location: 378488..378790 (303 bp)
Type: Toxin
Protein ID: WP_000229318.1
Type: Toxin
Protein ID: WP_000229318.1
Location: 379079..379303 (225 bp)
Type: Others
Protein ID: WP_001894423.1
Type: Others
Protein ID: WP_001894423.1
Location: 379747..379866 (120 bp)
Type: Others
Protein ID: WP_071919600.1
Type: Others
Protein ID: WP_071919600.1
Location: 379870..379923 (54 bp)
Type: Others
Protein ID: Protein_360
Type: Others
Protein ID: Protein_360
Location: 380525..381529 (1005 bp)
Type: Others
Protein ID: WP_000964931.1
Type: Others
Protein ID: WP_000964931.1
Location: 382304..382484 (181 bp)
Type: Others
Protein ID: Protein_362
Type: Others
Protein ID: Protein_362
Location: 382751..383038 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 383049..383366 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 383363..383473 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 375325..375822 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 375819..376091 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 377453..377722 (270 bp)
Type: Others
Protein ID: WP_000277238.1
Type: Others
Protein ID: WP_000277238.1
Location: 377715..377993 (279 bp)
Type: Others
Protein ID: WP_001258569.1
Type: Others
Protein ID: WP_001258569.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ85_RS15965 | 373386..373499 | + | 114 | WP_001900214.1 | hypothetical protein | - |
ASZ85_RS15970 | 373448..373729 | + | 282 | WP_001894429.1 | DUF1289 domain-containing protein | - |
ASZ85_RS15980 | 373987..374523 | + | 537 | WP_000469482.1 | GNAT family N-acetyltransferase | - |
ASZ85_RS15985 | 374660..375175 | + | 516 | WP_001201509.1 | lipocalin family protein | - |
ASZ85_RS15990 | 375325..375822 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
ASZ85_RS15995 | 375819..376091 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
ASZ85_RS20980 | 376484..376609 | + | 126 | WP_001900195.1 | DUF645 family protein | - |
ASZ85_RS20985 | 376625..376663 | + | 39 | WP_106019118.1 | hypothetical protein | - |
ASZ85_RS16005 | 376859..377305 | + | 447 | WP_000006157.1 | hypothetical protein | - |
ASZ85_RS16010 | 377453..377722 | - | 270 | WP_000277238.1 | type II toxin-antitoxin system YafQ family toxin | - |
ASZ85_RS16015 | 377715..377993 | - | 279 | WP_001258569.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
ASZ85_RS16020 | 378243..378500 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ASZ85_RS16025 | 378488..378790 | + | 303 | WP_000229318.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ85_RS16030 | 379079..379303 | + | 225 | WP_001894423.1 | DUF3709 domain-containing protein | - |
ASZ85_RS16035 | 379747..379866 | + | 120 | WP_071919600.1 | DUF645 family protein | - |
ASZ85_RS21000 | 379870..379923 | + | 54 | Protein_360 | DUF645 family protein | - |
ASZ85_RS16050 | 380525..381529 | + | 1005 | WP_000964931.1 | LD-carboxypeptidase | - |
ASZ85_RS16060 | 382304..382484 | + | 181 | Protein_362 | DUF645 family protein | - |
ASZ85_RS16065 | 382751..383038 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ASZ85_RS16070 | 383049..383366 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
ASZ85_RS21445 | 383363..383473 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 338285..496833 | 158548 | |
inside | Integron | - | - | 343365..496457 | 153092 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11751.69 Da Isoelectric Point: 5.1972
>T58396 WP_000229318.1 NZ_CP013318:378488-378790 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRIPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRIPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T58396 NZ_CP013318:378488-378790 [Vibrio cholerae]
ATGGTTGAAATAATTTGGACGGAGCCGGCTCTATCCGACCTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCATCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAATCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
ATGGTTGAAATAATTTGGACGGAGCCGGCTCTATCCGACCTGAATGATATTGCTGAATACATCGCGCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCATCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAATCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
Antitoxin
Download Length: 86 a.a. Molecular weight: 9647.15 Da Isoelectric Point: 7.3178
>AT58396 WP_000861987.1 NZ_CP013318:378243-378500 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK
Download Length: 258 bp
>AT58396 NZ_CP013318:378243-378500 [Vibrio cholerae]
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCCTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATG
TCAAAATGGTTGAAATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | C3LV30 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |