Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 417565..418093 | Replicon | chromosome |
Accession | NZ_CP025937 | ||
Organism | Vibrio cholerae strain A1552 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | C1H56_RS16750 | Protein ID | WP_000221354.1 |
Coordinates | 417806..418093 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | C1H56_RS16745 | Protein ID | WP_001250179.1 |
Coordinates | 417565..417816 (+) | Length | 84 a.a. |
Genomic Context
Location: 412833..413147 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 413284..413718 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 413886..414041 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 415214..415486 (273 bp)
Type: Others
Protein ID: Protein_444
Type: Others
Protein ID: Protein_444
Location: 415657..416349 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 416349..416750 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 416720..416863 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 416938..417351 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 417565..417816 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 417806..418093 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 418221..418676 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 418998..419150 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 420349..421017 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 421169..421456 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 421597..421968 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 422035..422460 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 422457..422990 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 414166..415146 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 419352..419849 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 419846..420118 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1H56_RS16705 | 412833..413147 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
C1H56_RS16710 | 413284..413718 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
C1H56_RS19860 | 413886..414041 | + | 156 | WP_000751734.1 | hypothetical protein | - |
C1H56_RS16715 | 414166..415146 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
C1H56_RS16720 | 415214..415486 | + | 273 | Protein_444 | CatB-related O-acetyltransferase | - |
C1H56_RS16725 | 415657..416349 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
C1H56_RS16730 | 416349..416750 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
C1H56_RS16735 | 416720..416863 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
C1H56_RS16740 | 416938..417351 | + | 414 | WP_000049417.1 | VOC family protein | - |
C1H56_RS16745 | 417565..417816 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
C1H56_RS16750 | 417806..418093 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C1H56_RS16755 | 418221..418676 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
C1H56_RS16760 | 418998..419150 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
C1H56_RS16770 | 419352..419849 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
C1H56_RS16775 | 419846..420118 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
C1H56_RS16780 | 420349..421017 | + | 669 | WP_000043871.1 | hypothetical protein | - |
C1H56_RS16785 | 421169..421456 | + | 288 | WP_000426470.1 | hypothetical protein | - |
C1H56_RS16790 | 421597..421968 | + | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
C1H56_RS20010 | 422035..422460 | + | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
C1H56_RS16800 | 422457..422990 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304067..433328 | 129261 | |
inside | Integron | catB9 | - | 309147..432952 | 123805 | ||
flank | IS/Tn | - | - | 414166..415146 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T92513 WP_000221354.1 NZ_CP025937:417806-418093 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T92513 NZ_CP025937:417806-418093 [Vibrio cholerae]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT92513 WP_001250179.1 NZ_CP025937:417565-417816 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT92513 NZ_CP025937:417565-417816 [Vibrio cholerae]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |