Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 398873..399451 | Replicon | chromosome |
Accession | NZ_CP013302 | ||
Organism | Vibrio cholerae strain C5 |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | ASZ80_RS16435 | Protein ID | WP_001180243.1 |
Coordinates | 398873..399190 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q7DCR7 |
Locus tag | ASZ80_RS16440 | Protein ID | WP_000557292.1 |
Coordinates | 399209..399451 (-) | Length | 81 a.a. |
Genomic Context
Location: 394064..394459 (396 bp)
Type: Others
Protein ID: WP_000046952.1
Type: Others
Protein ID: WP_000046952.1
Location: 394762..394943 (182 bp)
Type: Others
Protein ID: Protein_405
Type: Others
Protein ID: Protein_405
Location: 395120..395515 (396 bp)
Type: Others
Protein ID: WP_000046953.1
Type: Others
Protein ID: WP_000046953.1
Location: 395659..396195 (537 bp)
Type: Others
Protein ID: WP_000644491.1
Type: Others
Protein ID: WP_000644491.1
Location: 396492..396671 (180 bp)
Type: Others
Protein ID: WP_001883039.1
Type: Others
Protein ID: WP_001883039.1
Location: 396867..397292 (426 bp)
Type: Others
Protein ID: WP_000403014.1
Type: Others
Protein ID: WP_000403014.1
Location: 397441..397788 (348 bp)
Type: Others
Protein ID: WP_000933409.1
Type: Others
Protein ID: WP_000933409.1
Location: 397935..398228 (294 bp)
Type: Others
Protein ID: WP_125460920.1
Type: Others
Protein ID: WP_125460920.1
Location: 398584..398679 (96 bp)
Type: Others
Protein ID: WP_001907607.1
Type: Others
Protein ID: WP_001907607.1
Location: 399693..400202 (510 bp)
Type: Others
Protein ID: WP_000405987.1
Type: Others
Protein ID: WP_000405987.1
Location: 400259..400912 (654 bp)
Type: Others
Protein ID: WP_000226874.1
Type: Others
Protein ID: WP_000226874.1
Location: 401222..401440 (219 bp)
Type: Others
Protein ID: WP_001917086.1
Type: Others
Protein ID: WP_001917086.1
Location: 401843..402076 (234 bp)
Type: Others
Protein ID: WP_032482776.1
Type: Others
Protein ID: WP_032482776.1
Location: 402501..402681 (181 bp)
Type: Others
Protein ID: Protein_419
Type: Others
Protein ID: Protein_419
Location: 402948..403235 (288 bp)
Type: Others
Protein ID: WP_001162670.1
Type: Others
Protein ID: WP_001162670.1
Location: 403246..403563 (318 bp)
Type: Others
Protein ID: WP_001232701.1
Type: Others
Protein ID: WP_001232701.1
Location: 403560..403670 (111 bp)
Type: Others
Protein ID: WP_134814058.1
Type: Others
Protein ID: WP_134814058.1
Location: 403847..403972 (126 bp)
Type: Others
Protein ID: WP_001944767.1
Type: Others
Protein ID: WP_001944767.1
Location: 403988..404026 (39 bp)
Type: Others
Protein ID: WP_106019119.1
Type: Others
Protein ID: WP_106019119.1
Location: 398873..399190 (318 bp)
Type: Toxin
Protein ID: WP_001180243.1
Type: Toxin
Protein ID: WP_001180243.1
Location: 399209..399451 (243 bp)
Type: Antitoxin
Protein ID: WP_000557292.1
Type: Antitoxin
Protein ID: WP_000557292.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ80_RS16385 | 394064..394459 | + | 396 | WP_000046952.1 | hypothetical protein | - |
ASZ80_RS16390 | 394762..394943 | + | 182 | Protein_405 | DUF645 family protein | - |
ASZ80_RS16395 | 395120..395515 | + | 396 | WP_000046953.1 | hypothetical protein | - |
ASZ80_RS16400 | 395659..396195 | + | 537 | WP_000644491.1 | nucleotidyltransferase family protein | - |
ASZ80_RS16405 | 396492..396671 | + | 180 | WP_001883039.1 | DUF645 family protein | - |
ASZ80_RS16410 | 396867..397292 | + | 426 | WP_000403014.1 | GNAT family N-acetyltransferase | - |
ASZ80_RS16415 | 397441..397788 | + | 348 | WP_000933409.1 | hypothetical protein | - |
ASZ80_RS20580 | 397935..398228 | + | 294 | WP_125460920.1 | hypothetical protein | - |
ASZ80_RS20965 | 398584..398679 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
ASZ80_RS16435 | 398873..399190 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ80_RS16440 | 399209..399451 | - | 243 | WP_000557292.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ASZ80_RS16445 | 399693..400202 | + | 510 | WP_000405987.1 | GNAT family N-acetyltransferase | - |
ASZ80_RS16450 | 400259..400912 | + | 654 | WP_000226874.1 | hypothetical protein | - |
ASZ80_RS16455 | 401222..401440 | + | 219 | WP_001917086.1 | DUF3709 domain-containing protein | - |
ASZ80_RS16465 | 401843..402076 | + | 234 | WP_032482776.1 | DUF3709 domain-containing protein | - |
ASZ80_RS16470 | 402501..402681 | + | 181 | Protein_419 | DUF645 family protein | - |
ASZ80_RS16475 | 402948..403235 | + | 288 | WP_001162670.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
ASZ80_RS16480 | 403246..403563 | + | 318 | WP_001232701.1 | HigA family addiction module antidote protein | - |
ASZ80_RS20970 | 403560..403670 | + | 111 | WP_134814058.1 | DUF3265 domain-containing protein | - |
ASZ80_RS20975 | 403847..403972 | + | 126 | WP_001944767.1 | DUF645 family protein | - |
ASZ80_RS20980 | 403988..404026 | + | 39 | WP_106019119.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 304694..469286 | 164592 | |
inside | Integron | - | - | 309774..468910 | 159136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T58224 WP_001180243.1 NZ_CP013302:c399190-398873 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T58224 NZ_CP013302:c399190-398873 [Vibrio cholerae]
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
ATGCAAAATAAACAATATAAGCTCAGCCAATTAGCCCAAGAGCACTTACTCAAGATTAAACACTACACCATTGAAAATTT
CGCTGAAGCGCAGTGGCAAAAATATAAGTCGACCTTGCTTTCAGGTTTCCAAACTCTTGCGGATAACCCAGGACTAGGAA
AAAGCTGTGAAGATATTTACCAAAATGGTTTTTACTTTCCAGTGGGGAAACACATGGCTTATTACACCAAAGAAGCAAAC
TTCATTCTCATTGTTGCGGTATTAGGGCAATCACAACTGCCCCAAAAGCATCTCAAACAGTCACGCTTTGTTTCTTAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8961.25 Da Isoelectric Point: 5.6630
>AT58224 WP_000557292.1 NZ_CP013302:c399451-399209 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGATFLNTL
Download Length: 243 bp
>AT58224 NZ_CP013302:c399451-399209 [Vibrio cholerae]
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
ATGCACACACTAACAGCAAATGATGCTAAACGAAATTTTGGTGAACTTCTTCTAAGCGCACAACGCGAACCTGTCATCAT
CAGCAAAAACAGTAAGAATACTGTCGTTGTCATGTCCATTAAGGACTTTGAAGAACTTGAAGCAATGAAACTCGATTATC
TCAAACACTGCTTTGAGTCTGCTCAGAAAGACTTAGATAGTGGCAAAACCGTTGATGGTGCCACTTTTCTAAACACCCTT
TGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K9UJR8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7DCR7 |