Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-GNAT |
Location | 484793..485886 | Replicon | chromosome |
Accession | NZ_CP064351 | ||
Organism | Vibrio cholerae C6706 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q9KMA2 |
Locus tag | IT766_RS16255 | Protein ID | WP_000351248.1 |
Coordinates | 485485..485886 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | IT766_RS16250 | Protein ID | WP_001047169.1 |
Coordinates | 484793..485485 (+) | Length | 231 a.a. |
Genomic Context
Location: 480076..480453 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Location: 480510..480624 (115 bp)
Type: Others
Protein ID: Protein_490
Type: Others
Protein ID: Protein_490
Location: 480573..480854 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 481020..481133 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 481082..481309 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 481650..481982 (333 bp)
Type: Others
Protein ID: WP_000843587.1
Type: Others
Protein ID: WP_000843587.1
Location: 481969..482283 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 482420..482854 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 483022..483177 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 484350..484622 (273 bp)
Type: Others
Protein ID: Protein_499
Type: Others
Protein ID: Protein_499
Location: 484793..485485 (693 bp)
Type: Antitoxin
Protein ID: WP_001047169.1
Type: Antitoxin
Protein ID: WP_001047169.1
Location: 485485..485886 (402 bp)
Type: Toxin
Protein ID: WP_000351248.1
Type: Toxin
Protein ID: WP_000351248.1
Location: 485856..485999 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 486074..486487 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 486701..486952 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 486942..487229 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 487357..487812 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 488134..488286 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 489485..490153 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 490305..490592 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 483302..484282 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 488488..488985 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 488982..489254 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IT766_RS16195 | 480076..480453 | + | 378 | WP_000411109.1 | hypothetical protein | - |
IT766_RS16200 | 480510..480624 | + | 115 | Protein_490 | acetyltransferase | - |
IT766_RS16205 | 480573..480854 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
IT766_RS16210 | 481020..481133 | + | 114 | WP_001889158.1 | hypothetical protein | - |
IT766_RS16215 | 481082..481309 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
IT766_RS16220 | 481650..481982 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
IT766_RS16225 | 481969..482283 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
IT766_RS16230 | 482420..482854 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
IT766_RS16235 | 483022..483177 | + | 156 | WP_000751734.1 | hypothetical protein | - |
IT766_RS16240 | 483302..484282 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
IT766_RS16245 | 484350..484622 | + | 273 | Protein_499 | CatB-related O-acetyltransferase | - |
IT766_RS16250 | 484793..485485 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | Antitoxin |
IT766_RS16255 | 485485..485886 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
IT766_RS16260 | 485856..485999 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
IT766_RS16265 | 486074..486487 | + | 414 | WP_000049417.1 | VOC family protein | - |
IT766_RS16270 | 486701..486952 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
IT766_RS16275 | 486942..487229 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
IT766_RS16280 | 487357..487812 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
IT766_RS16285 | 488134..488286 | + | 153 | WP_001884520.1 | DUF645 family protein | - |
IT766_RS16290 | 488488..488985 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
IT766_RS16295 | 488982..489254 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
IT766_RS16300 | 489485..490153 | + | 669 | WP_000043871.1 | hypothetical protein | - |
IT766_RS16305 | 490305..490592 | + | 288 | WP_000426470.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 373204..502464 | 129260 | |
inside | Integron | - | - | 378284..502088 | 123804 | ||
flank | IS/Tn | - | - | 483302..484282 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T180875 WP_000351248.1 NZ_CP064351:485485-485886 [Vibrio cholerae C6706]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
>T180875 NZ_CP085767:c2310744-2310442 [Enterobacter hormaechei]
ATGAAGGAGATCGTTCAGACAGAATCCTTCCGACGCTGGGAGCAAAACTTAAAGGACAGGCGGGCAAAGACGATTATCGC
TTCCCGCCTCTTTAGGCTGGCAAATGGCTTAGCGGGCGACATTAGACCCGTGGGGGAAGGTATCAGTGAACTGAGGATCC
ACTTTGGCCCGGGCTACAGAGTCTATTTTAAGGACCAGGGCAATTGCATCATCGTGCTGTTATGTGGTGGTGACAAAAGC
AGCCAGGCCAGAGACATACTTATGGCAAAAATGCTGAGCAATGTATCCCAATGGCAGGAGTGA
ATGAAGGAGATCGTTCAGACAGAATCCTTCCGACGCTGGGAGCAAAACTTAAAGGACAGGCGGGCAAAGACGATTATCGC
TTCCCGCCTCTTTAGGCTGGCAAATGGCTTAGCGGGCGACATTAGACCCGTGGGGGAAGGTATCAGTGAACTGAGGATCC
ACTTTGGCCCGGGCTACAGAGTCTATTTTAAGGACCAGGGCAATTGCATCATCGTGCTGTTATGTGGTGGTGACAAAAGC
AGCCAGGCCAGAGACATACTTATGGCAAAAATGCTGAGCAATGTATCCCAATGGCAGGAGTGA
Antitoxin
Download Length: 231 a.a. Molecular weight: 26352.73 Da Isoelectric Point: 8.5633
>AT180875 WP_001047169.1 NZ_CP064351:484793-485485 [Vibrio cholerae C6706]
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
Download Length: 693 bp
>AT180875 NZ_CP085767:c2310435-2310148 [Enterobacter hormaechei]
ATGCATAAATTAACACCCTACGATCCAGCCAACGCACTGGTGGATGACGAGGAAATCGCTGTGTTTATGGCTGATGCATT
AGAAACGGGTGACTCAGCGTACATTGCTAAAGCGCTGGGCGTCATCGCCCGAGCGAAAGGGATGTCGACCATTTCCCAGC
AAACGGGCCTGTCACGAGAACAACTGTATCGATCATTCAGTGATAAGGGGAACCCAACGCTCAAAACCACGCTGGCGGTC
ATGAAAGCATTGGGCCTTGGGTTAACAATCAAACCCTCTGGGGATTAA
ATGCATAAATTAACACCCTACGATCCAGCCAACGCACTGGTGGATGACGAGGAAATCGCTGTGTTTATGGCTGATGCATT
AGAAACGGGTGACTCAGCGTACATTGCTAAAGCGCTGGGCGTCATCGCCCGAGCGAAAGGGATGTCGACCATTTCCCAGC
AAACGGGCCTGTCACGAGAACAACTGTATCGATCATTCAGTGATAAGGGGAACCCAACGCTCAAAACCACGCTGGCGGTC
ATGAAAGCATTGGGCCTTGGGTTAACAATCAAACCCTCTGGGGATTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0PN34 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |